SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30125.Seq
         (682 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC25B8.01 |dap1|SPAC26H5.15|cytochrome P450 regulator Dap1|Sch...    77   3e-15
SPAC4F10.10c |||mannosyltransferase complex subunit, Anp family ...    29   0.62 
SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces ...    29   0.62 
SPBC902.06 |mto2||MT organizer Mto2|Schizosaccharomyces pombe|ch...    27   3.3  
SPBC1A4.06c |||mitochondrial matrix protein import protein|Schiz...    27   3.3  
SPBC530.05 |||transcription factor |Schizosaccharomyces pombe|ch...    26   4.4  
SPCC550.13 |dfp1|rad35, him1|Hsk1-Dfp1 kinase complex regulatory...    26   5.8  
SPCC70.06 |||nuclear export factor|Schizosaccharomyces pombe|chr...    26   5.8  
SPCC4G3.10c |rhp42|rhp4b|DNA repair protein Rhp42|Schizosaccharo...    25   7.7  

>SPAC25B8.01 |dap1|SPAC26H5.15|cytochrome P450 regulator
           Dap1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 166

 Score = 76.6 bits (180), Expect = 3e-15
 Identities = 37/89 (41%), Positives = 57/89 (64%), Gaps = 6/89 (6%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT- 434
           T  EL++Y+G++    V +A+ G +++VT G++FYGP GPY+ F G DA+RGLA  S   
Sbjct: 44  TPAELKEYNGSKNS-LVFLAIKGTVYNVTMGSKFYGPQGPYSAFAGHDASRGLAKNSFDD 102

Query: 435 --APEKD---YDDLSDLNSMEMESVREWE 506
              P+ D    DD SDLN  E +++ +W+
Sbjct: 103 EFIPDSDAEELDDCSDLNDEERQALNDWK 131


>SPAC4F10.10c |||mannosyltransferase complex subunit, Anp family
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 337

 Score = 29.1 bits (62), Expect = 0.62
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = -3

Query: 614 AERTCLLLRVLRPSSSWVLHQASEV 540
           A R  LLL  L+PS+SWVL   S++
Sbjct: 166 ATRNTLLLSTLKPSTSWVLWLDSDI 190


>SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1427

 Score = 29.1 bits (62), Expect = 0.62
 Identities = 11/25 (44%), Positives = 19/25 (76%)
 Frame = -3

Query: 236 SFFKGATFEQCVLYL**NLYSITNV 162
           +FF+ AT +QC+L    +L+S+TN+
Sbjct: 15  NFFRNATLDQCLLLFYLSLFSLTNL 39


>SPBC902.06 |mto2||MT organizer Mto2|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 397

 Score = 26.6 bits (56), Expect = 3.3
 Identities = 14/40 (35%), Positives = 19/40 (47%)
 Frame = -1

Query: 370 PGP*NRFPLVTSNIHPFTAINTLPPSCVPSYCRSSTAVIL 251
           P P    P+  +  H  T +NT P S V + CRS   + L
Sbjct: 198 PSPIILKPVEQAVNHAITLVNTSPSSVVDALCRSLAELCL 237


>SPBC1A4.06c |||mitochondrial matrix protein import
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 383

 Score = 26.6 bits (56), Expect = 3.3
 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 2/34 (5%)
 Frame = +1

Query: 58  DSPPEVENVQAKHSGFFET--LKTLFCQPFIYFV 153
           ++P +VEN+ +K   FF    L  L+ +P ++F+
Sbjct: 242 ENPRKVENIVSKQIAFFRKLYLPLLYAEPGVHFI 275


>SPBC530.05 |||transcription factor |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 743

 Score = 26.2 bits (55), Expect = 4.4
 Identities = 11/35 (31%), Positives = 18/35 (51%)
 Frame = +2

Query: 521 NYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDD 625
           NYD    ++ P   P+NY D    + +TS+  + D
Sbjct: 75  NYDQQPDIIHPSSTPKNYHDLNCTKGETSSDDSTD 109


>SPCC550.13 |dfp1|rad35, him1|Hsk1-Dfp1 kinase complex regulatory
           subunit Dfp1 |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 545

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 20/69 (28%), Positives = 26/69 (37%)
 Frame = +3

Query: 396 RDATRGLATFSVTAPEKDYDDLSDLNSMEMESVREWEDNLERIMIWSVDF*GLVKNPGTT 575
           R A   L      + +K+Y      N  + E +  W+DN E       DF   V N    
Sbjct: 11  RSANIVLPKHDAVSKQKEYRIEEKTNEAQREEIITWKDNREDEGEVKTDF--EVVNNENI 68

Query: 576 RTKNPKKQT 602
            T  PK QT
Sbjct: 69  ITTTPKHQT 77


>SPCC70.06 |||nuclear export factor|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 458

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = -1

Query: 232 FSREQPLNNVSYTCSKIYTVSQMYSQKQNK*TVDKTVFLRSQKSHCVWLAHFQPLVV 62
           FSR+Q +  +S +   +YT+ Q+Y             ++  +K HC   A F+  +V
Sbjct: 203 FSRQQEIEQLSKSMEILYTLGQLYD------------YMHLRKEHCTHEAEFRAYMV 247


>SPCC4G3.10c |rhp42|rhp4b|DNA repair protein
           Rhp42|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 686

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = +2

Query: 518 ENYDLVGRLLRPGEEPR 568
           ENY   GR+++ GE+PR
Sbjct: 505 ENYHKEGRVIKEGEQPR 521


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,891,078
Number of Sequences: 5004
Number of extensions: 60274
Number of successful extensions: 211
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 200
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 210
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 313902888
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -