SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces...   139   3e-34
SPBC16A3.15c |nda2||tubulin alpha 1|Schizosaccharomyces pombe|ch...    86   5e-18
SPBC800.05c |tub1|atb2, alp2, ban5|tubulin alpha 2|Schizosacchar...    86   5e-18
SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|...    69   9e-13
SPAC343.17c |||WD repeat protein, human WDR70 family|Schizosacch...    27   1.9  
SPBC947.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2||...    27   3.4  
SPAC6C3.08 |||gankyrin|Schizosaccharomyces pombe|chr 1|||Manual        26   4.5  
SPCC18.04 |pof6||F-box protein Pof6|Schizosaccharomyces pombe|ch...    26   5.9  
SPCC736.11 |ago1|csp9|argonaute|Schizosaccharomyces pombe|chr 3|...    25   7.9  

>SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 448

 Score =  139 bits (337), Expect = 3e-34
 Identities = 71/145 (48%), Positives = 90/145 (62%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           Q ER+NVY+NEA+ GKYVPR VL+DL+P TMDAV+SG FG LFRPDN +YGQ+ A N WA
Sbjct: 43  QHERLNVYFNEAAGGKYVPRAVLVDLEPGTMDAVKSGKFGNLFRPDNIIYGQSGAGNIWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+ ++ LDV+RREAE   A +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELADAVLDVVRREAEACDALQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 MMATFSVAPAPKSSDTVVEPYNATL 187



 Score = 66.9 bits (156), Expect = 3e-12
 Identities = 24/41 (58%), Positives = 32/41 (78%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSD 252
           MREI+++Q G CGNQ+G  FW  I+DEHG+D +G YHG S+
Sbjct: 1   MREIVHIQAGQCGNQVGAAFWSTIADEHGLDSAGIYHGTSE 41


>SPBC16A3.15c |nda2||tubulin alpha 1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 455

 Score = 85.8 bits (203), Expect = 5e-18
 Identities = 35/76 (46%), Positives = 56/76 (73%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEG 455
           +++E   GK+VPR++ +DL+P  +D VR+GP+  LF P+  V G+  A+NN+A+GHYT G
Sbjct: 56  FFSETGQGKFVPRSIYVDLEPNVIDQVRTGPYKDLFHPEQMVTGKEDASNNYARGHYTVG 115

Query: 456 VEILESALDVIRREAE 503
            E+++S L+ IRR A+
Sbjct: 116 KEMIDSVLERIRRMAD 131



 Score = 44.0 bits (99), Expect = 2e-05
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGS 270
           MRE+I++ VG  G QIG   WE+   EHGI P G    +S+++   S
Sbjct: 1   MREVISVHVGQAGVQIGNACWELYCLEHGIGPDGFPTENSEVHKNNS 47



 Score = 26.6 bits (56), Expect = 3.4
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVS 655
           + R+  EY  +  L FSV+P+P+VS
Sbjct: 158 LERLNMEYGKKSNLQFSVYPAPQVS 182


>SPBC800.05c |tub1|atb2, alp2, ban5|tubulin alpha
           2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 449

 Score = 85.8 bits (203), Expect = 5e-18
 Identities = 50/147 (34%), Positives = 79/147 (53%), Gaps = 7/147 (4%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYT 449
           + +++E   GKYVPR++ +DL+P  +D VR+GP+  LF P+  + G+  A+NN+A+GHYT
Sbjct: 50  STFFSETGQGKYVPRSIYVDLEPNVIDQVRTGPYRDLFHPEQLITGKEDASNNYARGHYT 109

Query: 450 EGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAKSIP 608
            G E+++   D IRR A      +G++    F   T + +      R A     Y K   
Sbjct: 110 VGKELVDEVTDKIRRIADNCSGLQGFLVFHSFGGGTGSGFGALLLERLAME---YTKKSK 166

Query: 609 TELY*PFQSFQVPECRICVVEPYNTTL 689
            +    F  +  P+    VVEPYN+ L
Sbjct: 167 LQ----FSVYPAPQVSTSVVEPYNSVL 189



 Score = 46.4 bits (105), Expect = 4e-06
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGD-SDLNSKGSTCT 279
           MREII++ VG  G QIG   WE+   EHGI P+G  + + +  NS G   T
Sbjct: 1   MREIISIHVGQAGTQIGNACWELYCLEHGIQPNGYMNPETASQNSDGGFST 51



 Score = 26.6 bits (56), Expect = 3.4
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVS 655
           + R+  EY  +  L FSV+P+P+VS
Sbjct: 154 LERLAMEYTKKSKLQFSVYPAPQVS 178


>SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 446

 Score = 68.5 bits (160), Expect = 9e-13
 Identities = 31/85 (36%), Positives = 54/85 (63%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 LERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNW 431
           ++R +V++ ++   +Y+PR +LIDL+P  ++ + S  +G L+ P+N +  +N   A NNW
Sbjct: 45  VDRKDVFFYQSDDTRYIPRAILIDLEPRVVNNILSDTYGSLYNPENILITKNGGGAGNNW 104

Query: 432 AKGHYTEGVEILESALDVIRREAEG 506
           A G Y+    I E  +D+I REA+G
Sbjct: 105 ANG-YSHAERIFEDIMDMIDREADG 128



 Score = 52.0 bits (119), Expect = 8e-08
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQAGQCGNQIGSQFWQQLCLEHGIGPDG 35



 Score = 31.9 bits (69), Expect = 0.090
 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%)
 Frame = +2

Query: 575 YFVNRIREEYPDRIILTFSVFP-SPRVSDL 661
           + + R+ + YP +II T+SVFP S  VSD+
Sbjct: 152 FLLERLNDRYPKKIIQTYSVFPNSQSVSDV 181


>SPAC343.17c |||WD repeat protein, human WDR70
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 576

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 17/50 (34%), Positives = 21/50 (42%)
 Frame = +2

Query: 224 QADATTATPTSTRKDQRVLQRGIGWEICSSHGSYRLEAGHDGRGEVGTLR 373
           Q  + T  P    KD  + Q+GI     S  G+Y L  G D    V  LR
Sbjct: 279 QKGSRTKRPVMKIKDAHLPQQGISCLSFSQDGNYLLSRGEDNALRVWDLR 328


>SPBC947.14c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 103

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 14/42 (33%), Positives = 23/42 (54%)
 Frame = +3

Query: 213 RHRSKRMLPRRLRPQLERINVYYNEASAGKYVPRTVLIDLKP 338
           R R ++M P++   QL  +N   +     KY+P+ V+  LKP
Sbjct: 34  RARLQKMPPQQANKQLNALNNLLDNVYWNKYIPKQVV--LKP 73


>SPAC6C3.08 |||gankyrin|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 234

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 10/28 (35%), Positives = 18/28 (64%)
 Frame = +3

Query: 432 AKGHYTEGVEILESALDVIRREAEGWIA 515
           A+GH   GVE++ +  D +R+++E   A
Sbjct: 183 AEGHPDVGVELVRAGADTLRKDSENHTA 210


>SPCC18.04 |pof6||F-box protein Pof6|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 872

 Score = 25.8 bits (54), Expect = 5.9
 Identities = 9/27 (33%), Positives = 16/27 (59%)
 Frame = +1

Query: 361 RDPSDAYSDRTISSTDKTVRPTTGRRD 441
           + P + +SD+TI S   T+ PT   ++
Sbjct: 702 KTPMNLFSDQTIGSITNTIEPTAAAKN 728


>SPCC736.11 |ago1|csp9|argonaute|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 834

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 13/44 (29%), Positives = 18/44 (40%)
 Frame = +1

Query: 181 GKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGNMFL 312
           G+F  VI+DE       C+      N K   CTT +      F+
Sbjct: 656 GQFLSVINDELSQIKEACHSLSPKYNPKILVCTTQKRHHARFFI 699


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,796,410
Number of Sequences: 5004
Number of extensions: 56246
Number of successful extensions: 163
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 148
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 161
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 321951680
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -