SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30122.Seq
         (669 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC18H10.12c |rpl701||60S ribosomal protein L7|Schizosaccharomy...    80   3e-16
SPAC664.06 |rpl703|rpl7|60S ribosomal protein L7|Schizosaccharom...    78   1e-15
SPAC3H5.07 |rpl702|rpl7-2, rpl7, rpl7b|60S ribosomal protein L7|...    76   5e-15
SPAC22A12.16 |||ATP-citrate synthase subunit 2 |Schizosaccharomy...    25   7.5  
SPBC16G5.02c |||ribokinase |Schizosaccharomyces pombe|chr 2|||Ma...    25   7.5  
SPAC1039.01 |||amino acid permease, unknown 5|Schizosaccharomyce...    25   7.5  

>SPBC18H10.12c |rpl701||60S ribosomal protein L7|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 251

 Score = 79.8 bits (188), Expect = 3e-16
 Identities = 39/88 (44%), Positives = 55/88 (62%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + RK++QL RL QINNGVFV+ NKAT  ML++ EPY+ +G PNLK+VREL+         
Sbjct: 106 KARKIMQLLRLIQINNGVFVKFNKATKEMLQVVEPYVTYGIPNLKTVRELLYKRGFGKVN 165

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    A++     K++I+ +EDLI
Sbjct: 166 KQRIALSDNAIIEAALGKYSILSIEDLI 193



 Score = 49.6 bits (113), Expect = 4e-07
 Identities = 22/34 (64%), Positives = 24/34 (70%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GNYYVP E KL FVIRIRGIN + PK+ K    L
Sbjct: 81  GNYYVPDETKLVFVIRIRGINNIPPKARKIMQLL 114



 Score = 38.3 bits (85), Expect = 0.001
 Identities = 21/63 (33%), Positives = 33/63 (52%)
 Frame = +3

Query: 69  SKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERD 248
           SK+    PES+LK            +    +++++  KK+  I KRAE Y  EYR  ER+
Sbjct: 10  SKEQIFAPESLLKKKKTQEQSREQRVAAAAEKKAAQQKKRELIAKRAESYDAEYRKAERE 69

Query: 249 EID 257
           +I+
Sbjct: 70  QIE 72



 Score = 28.7 bits (61), Expect = 0.80
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG  FK A+NF
Sbjct: 194 HEIYTVGPNFKQAANF 209


>SPAC664.06 |rpl703|rpl7|60S ribosomal protein
           L7|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 249

 Score = 78.2 bits (184), Expect = 1e-15
 Identities = 40/88 (45%), Positives = 53/88 (60%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           ++RKVL+L RL +INN VFVR NKA   MLRI EPY+ +G PNL SVREL+         
Sbjct: 104 KIRKVLRLLRLSRINNAVFVRNNKAVAQMLRIVEPYVMYGIPNLHSVRELIYKRGFGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+     K+++I +ED+I
Sbjct: 164 GQRIALSDNALIEEALGKYDVISIEDII 191



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +3

Query: 90  PESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEI 254
           PE +LK            ++  + ++ +  K ++E FKRAE ++  YR +ER+ I
Sbjct: 15  PEVLLKKRKVNERTRKERVEQAIAKKEAQKKNRKETFKRAETFINNYRQRERERI 69



 Score = 34.7 bits (76), Expect = 0.012
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G+ +VP E KL FVIRI G+  + PK  K    L
Sbjct: 79  GDIFVPDETKLLFVIRIAGVKNMPPKIRKVLRLL 112


>SPAC3H5.07 |rpl702|rpl7-2, rpl7, rpl7b|60S ribosomal protein
           L7|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 250

 Score = 75.8 bits (178), Expect = 5e-15
 Identities = 37/88 (42%), Positives = 53/88 (60%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + RK++QL RL QINNG+FV+ NKA   ML++ EPY+ +G PN K+VREL+         
Sbjct: 105 KARKIMQLLRLLQINNGIFVKFNKAIKEMLQVVEPYVTYGIPNHKTVRELIYKRGFGKVN 164

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    A++     K++I+ VEDLI
Sbjct: 165 KQRIPLSDNAIIEAALGKYSILSVEDLI 192



 Score = 46.4 bits (105), Expect = 4e-06
 Identities = 20/34 (58%), Positives = 24/34 (70%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GNY+VP E KL FV+RIRGIN + PK+ K    L
Sbjct: 80  GNYFVPHEPKLIFVVRIRGINNIPPKARKIMQLL 113



 Score = 39.1 bits (87), Expect = 6e-04
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +3

Query: 90  PESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEID 257
           PES+LK            +    +++S+  KK+  I KRAE Y  EYR  ER++I+
Sbjct: 16  PESLLKKTKAQKQSREQIVAAAAEKKSARQKKRELIAKRAEAYEAEYRAAEREQIE 71



 Score = 28.7 bits (61), Expect = 0.80
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG  FK A+NF
Sbjct: 193 HEIYTVGPNFKQAANF 208


>SPAC22A12.16 |||ATP-citrate synthase subunit 2 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 492

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = -2

Query: 260 LVDFITFLDAVFLDVLFSPLEDFPLLL 180
           LVDFI  L +V++D  F+ LE  PL++
Sbjct: 211 LVDFIIRLYSVYVDCQFTYLEINPLVV 237


>SPBC16G5.02c |||ribokinase |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 318

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 1/68 (1%)
 Frame = +1

Query: 400 NGVFVRLNKA-TVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDNVYQSLPTALLRR 576
           +GV V +N A  + +      Y A+  PN      L++  DSP+ ++NV  +  + LL  
Sbjct: 162 HGVDVLMNPAPAIPLSHDMISYCAYLVPNEHEAAILLNQADSPATLENV-DAYASKLLSF 220

Query: 577 GFHKHNII 600
           G  K  II
Sbjct: 221 GVRKAVII 228


>SPAC1039.01 |||amino acid permease, unknown 5|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 567

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = -2

Query: 278 DCVLVWLVDFITFLDAVFLDVLFS 207
           +C++  L+ F+TF   V LD +FS
Sbjct: 410 NCIISILILFLTFAGTVTLDAVFS 433


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,572,248
Number of Sequences: 5004
Number of extensions: 52509
Number of successful extensions: 139
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 126
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 136
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 305854096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -