SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30120.Seq
         (576 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pom...    27   2.0  
SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces...    27   2.0  
SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyc...    25   6.0  
SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyce...    25   7.9  
SPAC9.07c |||GTPase Rbg1 |Schizosaccharomyces pombe|chr 1|||Manual     25   7.9  
SPAC57A10.12c |ura3||dihydroorotate dehydrogenase Ura3|Schizosac...    25   7.9  
SPAC19A8.12 |dcp2||mRNA decapping complex subunit Dcp2|Schizosac...    25   7.9  
SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|ch...    25   7.9  

>SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 158

 Score = 27.1 bits (57), Expect = 2.0
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -2

Query: 485 GIPVIRPLMMESTALGAAIVAGRAMRVW 402
           GIP+I P+      L  A+ + RA ++W
Sbjct: 131 GIPIIDPVTRAPAVLAGAVSSSRAKQMW 158


>SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 897

 Score = 27.1 bits (57), Expect = 2.0
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = -2

Query: 290 WTDTKNEHVNAENQIELLQFCRRDFFSSEPPY 195
           W +T+N   +  N +E+L    R+   S P Y
Sbjct: 764 WANTENARYSTSNALEILDMLLREKIESAPRY 795


>SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1679

 Score = 25.4 bits (53), Expect = 6.0
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = -3

Query: 553 RQLLADGGMAQNSVLCRCRLIYWVYQSFVPS*WK 452
           +++ +D   +Q +V  R  L+ W++ S  PS WK
Sbjct: 162 QRIFSDLQFSQKTVDYRLSLLRWIHLSSWPSNWK 195


>SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1242

 Score = 25.0 bits (52), Expect = 7.9
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +3

Query: 363 QECIGRWAGYCRGPHTHCATC 425
           QEC+  W G+ +   THC  C
Sbjct: 36  QECLVEWLGHSK--KTHCELC 54


>SPAC9.07c |||GTPase Rbg1 |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 366

 Score = 25.0 bits (52), Expect = 7.9
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +1

Query: 379 GGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACI-CTELSSAPSL 534
           GGLG  V  T I     +  P    S +  ++TG  S++A    T L++ P +
Sbjct: 52  GGLGFDVARTGIGTVGFIGFPSVGKSTLMTQLTGTRSEAAAYEFTTLTTVPGV 104


>SPAC57A10.12c |ura3||dihydroorotate dehydrogenase
           Ura3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 443

 Score = 25.0 bits (52), Expect = 7.9
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +1

Query: 388 GIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICT 510
           G++VG+T + RP T+ +   V     G ++G P K   + T
Sbjct: 330 GVIVGNTTVQRPKTLKSTSHVEE--TGGLSGPPLKPIALNT 368


>SPAC19A8.12 |dcp2||mRNA decapping complex subunit
           Dcp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 741

 Score = 25.0 bits (52), Expect = 7.9
 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%)
 Frame = +3

Query: 288 PSHAFIQGFFPTNSPHFSFF-IGKSRQECIGRWAGYCRGPHT 410
           PS  + Q F+P  S   S + +GK+ Q   G  + Y  G  T
Sbjct: 410 PSTVYHQVFYPPTSTSVSSYGLGKTPQPAYGSSSPYVNGHQT 451


>SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 628

 Score = 25.0 bits (52), Expect = 7.9
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = +2

Query: 386 WVLSWATHALRDLRQWPPPGLYF 454
           W L+    A  D+R WPP  ++F
Sbjct: 403 WTLTDLADAFLDVRLWPPIFMFF 425


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,274,979
Number of Sequences: 5004
Number of extensions: 48077
Number of successful extensions: 111
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 107
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 111
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 246098644
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -