SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30119.Seq
         (448 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces...    97   1e-21
SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc...    30   0.19 
SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosacc...    27   1.3  
SPAC806.08c |mod21||gamma tubulin complex subunit Mod21|Schizosa...    26   2.3  
SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ...    26   3.0  
SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Sp...    25   7.0  
SPBC36B7.04 |||tRNA dihydrouridine synthase Dus1 |Schizosaccharo...    24   9.3  
SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo...    24   9.3  
SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosa...    24   9.3  

>SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 113

 Score = 97.1 bits (231), Expect = 1e-21
 Identities = 44/68 (64%), Positives = 54/68 (79%)
 Frame = +3

Query: 72  KSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLW 251
           KSAIN+VVTR+YT+++HKRL+GV FKKRAPRAIKEI  FA+K M T ++RVD  LNK +W
Sbjct: 6   KSAINQVVTRDYTIHMHKRLYGVSFKKRAPRAIKEIVAFAQKHMQTKEVRVDPSLNKEVW 65

Query: 252 SRGSEMFP 275
            RG    P
Sbjct: 66  KRGIRNVP 73


>SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 898

 Score = 29.9 bits (64), Expect = 0.19
 Identities = 21/72 (29%), Positives = 31/72 (43%)
 Frame = -1

Query: 220 RMSGVPICFSANFRISLIALGARFLNPTP*SRLCKLTVYSRVTTSFMADLPFLSPLGLAI 41
           R+  +P+ F    R+    +G   L PT   R+ K   Y    TS M  L  +S LGL +
Sbjct: 45  RLIHIPLSFLQQPRVIAEIIGGIVLGPTVMGRIPKFLDYI-FPTSSMGPLNLVSNLGLVL 103

Query: 40  VILSFVYRIQLR 5
            +      + LR
Sbjct: 104 FLFVIGMEVDLR 115


>SPAC1F8.03c |str3||siderophore-iron transporter Str3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 630

 Score = 27.1 bits (57), Expect = 1.3
 Identities = 13/41 (31%), Positives = 21/41 (51%)
 Frame = -3

Query: 245 EFV*ASVYSNVRSSHLFFSELSDFFDCSWGTLFKSNTMKSF 123
           E V  S+Y N R  +L ++       CSW +  +S+T  S+
Sbjct: 68  EAVRDSIYQNKRGMYLAYAFGIAILACSWASAIQSSTTYSY 108


>SPAC806.08c |mod21||gamma tubulin complex subunit
           Mod21|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 618

 Score = 26.2 bits (55), Expect = 2.3
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -3

Query: 365 QQARKSLV*ITYVRNLHHHYVFVKTSH 285
           ++A+KSL    + R  + HYVFV T H
Sbjct: 452 EEAKKSLWSKRFSRFYYGHYVFVNTCH 478


>SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 673

 Score = 25.8 bits (54), Expect = 3.0
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = -2

Query: 420 GVYSWLASTFSVCKPLID 367
           GV  WLAST+S C  +++
Sbjct: 464 GVVCWLASTYSFCDGIVN 481


>SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor
           Spt6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1365

 Score = 24.6 bits (51), Expect = 7.0
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 81  INEVVTREYTVNLHKRLHGVGFKKRAPRAIKEI 179
           INE VT +Y  N+   + G+G  ++A   +K+I
Sbjct: 860 INEAVTNKYEANILPYIAGLG-PRKADYVLKKI 891


>SPBC36B7.04 |||tRNA dihydrouridine synthase Dus1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 399

 Score = 24.2 bits (50), Expect = 9.3
 Identities = 12/38 (31%), Positives = 17/38 (44%)
 Frame = -1

Query: 256 LDQRNLFKRVSTRMSGVPICFSANFRISLIALGARFLN 143
           +DQ  L  R+  R SG  +C+S  F   L      + N
Sbjct: 26  VDQSELPWRILARRSGADLCYSPMFHSRLFGESEDYRN 63


>SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1616

 Score = 24.2 bits (50), Expect = 9.3
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -1

Query: 109  VYSRVTTSFMADLPFLSPLGLAIVILS 29
            V+   +TSF  D+ FLS L LA+  L+
Sbjct: 1237 VFYEESTSFALDVDFLSSLQLAVESLT 1263


>SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 509

 Score = 24.2 bits (50), Expect = 9.3
 Identities = 11/36 (30%), Positives = 17/36 (47%)
 Frame = +3

Query: 231 RLNKFLWSRGSEMFPPVSV*GFHEDVMMMKIPHISY 338
           +L  F WS      P   +  + +D  + KIP+I Y
Sbjct: 132 KLTAFAWSVYDGRLPSSELSSYQKDRALRKIPNILY 167


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,716,815
Number of Sequences: 5004
Number of extensions: 31779
Number of successful extensions: 58
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 58
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 164204010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -