SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30114.Seq
         (672 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1F5.02 |||protein disulfide isomerase|Schizosaccharomyces po...    65   8e-12
SPAC13F5.05 |||thioredoxin family protein|Schizosaccharomyces po...    51   2e-07
SPAC17H9.14c |||protein disulfide isomerase|Schizosaccharomyces ...    49   7e-07
SPAC7D4.07c |trx1||cytosolic thioredoxin Trx1 |Schizosaccharomyc...    41   1e-04
SPBC577.08c |txl1|trx3|thioredoxin-like I protein Txl1|Schizosac...    40   4e-04
SPBC12D12.07c |trx2||mitochondrial thioredoxin Trx2|Schizosaccha...    36   0.004
SPAC959.05c |||protein disulfide isomerase |Schizosaccharomyces ...    34   0.021
SPBC4B4.11 |||conserved fungal protein|Schizosaccharomyces pombe...    30   0.35 
SPBC3D6.13c |||protein disulfide isomerase |Schizosaccharomyces ...    29   0.61 
SPBC26H8.06 |grx4||glutaredoxin Grx4|Schizosaccharomyces pombe|c...    28   1.4  
SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9...    27   1.9  
SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr 3|||Ma...    25   7.5  
SPCC330.08 |alg11|gmd3|alpha-1,2-mannosyltransferase Alg11|Schiz...    25   9.9  
SPCC306.03c |cnd2||condensin subunit Cnd2|Schizosaccharomyces po...    25   9.9  

>SPAC1F5.02 |||protein disulfide isomerase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 492

 Score = 65.3 bits (152), Expect = 8e-12
 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAVEV 432
           L +VD T+E DL   Y +RGYPTL  F+NG  I  YSG R+ D ++ +++K+   P V+ 
Sbjct: 75  LVEVDCTEEGDLCSEYSIRGYPTLNVFKNGKQISQYSGPRKHDALVKYMRKQL-LPTVKP 133

Query: 433 TSAEQAKELID-ANTVIVFGFFSDQ 504
            S +  +  ++ A+ + V  FF DQ
Sbjct: 134 ISKDTLENFVEKADDLAVVAFFKDQ 158



 Score = 63.7 bits (148), Expect = 2e-11
 Identities = 29/70 (41%), Positives = 48/70 (68%), Gaps = 1/70 (1%)
 Frame = +2

Query: 86  TEENVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*R 262
           ++E+++VL   NF+ ++   T+ +LVEFYAPWCGHCK+LAP Y K A + +++ + +   
Sbjct: 353 SQEDLVVLVADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLAEEYSDDSNVVV-A 411

Query: 263 KLTQLKNRIS 292
           K+   +N IS
Sbjct: 412 KIDATENDIS 421



 Score = 58.8 bits (136), Expect = 7e-10
 Identities = 22/45 (48%), Positives = 33/45 (73%)
 Frame = +2

Query: 107 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           ++K     +IT  + ++V+FYAPWCGHCK+LAPEY  AA +L ++
Sbjct: 27  VNKEGLNELITADKVLMVKFYAPWCGHCKALAPEYESAADELEKD 71



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 19/53 (35%), Positives = 34/53 (64%), Gaps = 3/53 (5%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKK 405
           +AK+DAT E D++ S  + G+PT+ FF+     +P+ Y G R  +D+ +++ K
Sbjct: 410 VAKIDAT-ENDISVS--ISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFIDK 459


>SPAC13F5.05 |||thioredoxin family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 363

 Score = 50.8 bits (116), Expect = 2e-07
 Identities = 24/67 (35%), Positives = 31/67 (46%)
 Frame = +2

Query: 32  LIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 211
           L     +L+    G       N + L+  NF   +      LV FYAPWCG+CK L P Y
Sbjct: 11  LFLACFSLVSGVFGYSPMFGSNTIELNSKNFRKFVKAKGPSLVVFYAPWCGYCKKLVPTY 70

Query: 212 AKAATKL 232
            K A+ L
Sbjct: 71  QKLASNL 77



 Score = 27.9 bits (59), Expect = 1.4
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 6/65 (9%)
 Frame = +1

Query: 268 DATQEQDLAESYGVRGYPTLKFF---RNGSPI---DYSGGRQADDIISWLKKKTGPPAVE 429
           DA Q + +   Y V+G+PT+K       GS +   DY+G R    +  ++     P  V+
Sbjct: 89  DADQNRAVCSQYQVQGFPTIKLVYPSSKGSSLSSTDYNGDRSYKSLQKFVSDSI-PSKVK 147

Query: 430 VTSAE 444
           + ++E
Sbjct: 148 ILTSE 152


>SPAC17H9.14c |||protein disulfide isomerase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 359

 Score = 48.8 bits (111), Expect = 7e-07
 Identities = 21/40 (52%), Positives = 27/40 (67%), Gaps = 1/40 (2%)
 Frame = +2

Query: 95  NVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEY 211
           NV+ L   NF+ V+   +  +LVEFYA WCG+CK LAP Y
Sbjct: 141 NVVELDSLNFDKVVMDDKKDVLVEFYADWCGYCKRLAPTY 180



 Score = 47.6 bits (108), Expect = 2e-06
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF-RNGS-PIDYSGGRQADDIISWLKKKTGPPAVE 429
           + K+DA    D+A+ Y + G+PTL +F  +GS P+ YS  R  D +  ++ +KTG    +
Sbjct: 76  IGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDSLTQFVSEKTGIKKRK 135

Query: 430 VTSAEQAKELIDAN 471
           +       EL   N
Sbjct: 136 IVLPSNVVELDSLN 149



 Score = 46.4 bits (105), Expect = 4e-06
 Identities = 24/65 (36%), Positives = 34/65 (52%)
 Frame = +2

Query: 17  IEMRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKS 196
           + + +L F   AL  L     V   +++  L      T+  + +  L+EFYA WCGHCKS
Sbjct: 1   MRLPLLSFVIFALFALVFASGVVELQSLNELEN----TIRASKKGALIEFYATWCGHCKS 56

Query: 197 LAPEY 211
           LAP Y
Sbjct: 57  LAPVY 61



 Score = 36.3 bits (80), Expect = 0.004
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKKTG 414
           ++ K++A    D+   + V  +PT+KFF       P  Y G R  + +I ++ KK+G
Sbjct: 194 EIVKINADVFADIGRLHEVASFPTIKFFPKDDKDKPELYEGDRSLESLIEYINKKSG 250


>SPAC7D4.07c |trx1||cytosolic thioredoxin Trx1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 103

 Score = 41.1 bits (92), Expect = 1e-04
 Identities = 12/36 (33%), Positives = 26/36 (72%)
 Frame = +2

Query: 104 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 211
           V   + F++++   + ++V+F+A WCG CK++AP++
Sbjct: 5   VSDSSEFKSIVCQDKLVVVDFFATWCGPCKAIAPKF 40



 Score = 27.1 bits (57), Expect = 2.5
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID 357
           KVD  Q  ++A   GV   P+   ++NG  I+
Sbjct: 54  KVDVDQLSEIAAEAGVHAMPSFFLYKNGEKIE 85


>SPBC577.08c |txl1|trx3|thioredoxin-like I protein
           Txl1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 290

 Score = 39.5 bits (88), Expect = 4e-04
 Identities = 15/44 (34%), Positives = 29/44 (65%)
 Frame = +2

Query: 104 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           + S  ++ + I  + Y+ V+ YA WCG CK+++P +++ A+K A
Sbjct: 6   IRSYQHWISTIPKSGYLAVDCYADWCGPCKAISPLFSQLASKYA 49



 Score = 36.3 bits (80), Expect = 0.004
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 4/72 (5%)
 Frame = +1

Query: 250 YQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGR--QA--DDIISWLKKKTGP 417
           +  AKV+  +++ +A   GV+  PT  FF NG  ID   G   QA  + +     K TG 
Sbjct: 53  FVFAKVNVDEQRQIASGLGVKAMPTFVFFENGKQIDMLTGANPQALKEKVALISSKATGT 112

Query: 418 PAVEVTSAEQAK 453
            A+  +S+   K
Sbjct: 113 GALASSSSAPVK 124


>SPBC12D12.07c |trx2||mitochondrial thioredoxin
           Trx2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 121

 Score = 36.3 bits (80), Expect = 0.004
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 104 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 205
           V S  ++ T I+  +  +V+FYA WCG CK L P
Sbjct: 22  VESFGDYNTRISADKVTVVDFYADWCGPCKYLKP 55



 Score = 31.1 bits (67), Expect = 0.15
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = +1

Query: 265 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 405
           V+A +  D+A+  GV   PT+  FR G  +D   G     + S L K
Sbjct: 72  VNADKFSDIAQKNGVYALPTMVLFRKGQELDRIVGADVKTLSSLLAK 118


>SPAC959.05c |||protein disulfide isomerase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 632

 Score = 33.9 bits (74), Expect = 0.021
 Identities = 11/64 (17%), Positives = 35/64 (54%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           ++A+V+  +E+++   + ++ +PT + F+    I Y+G  +   ++S+  +     A+++
Sbjct: 231 KMAQVNCDEEKEMCNHFHIKKFPTFRVFQGFDSIQYNGPLKYQQLLSYSNQVASYQAIKI 290

Query: 433 TSAE 444
              +
Sbjct: 291 EEGD 294



 Score = 28.7 bits (61), Expect = 0.81
 Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 8/73 (10%)
 Frame = +1

Query: 241 RISYQLAKVDAT---QEQDLAESYGVRGYPTLKFFRNGSPIDYSG--GRQADD---IISW 396
           R+  QLA V        + LA  YG +  P++   RNG PI Y     R+  D   I  W
Sbjct: 324 RLKLQLAGVAPLYICNSKALANKYGAQSQPSIIAVRNGMPIVYQAITPREFRDYKRITEW 383

Query: 397 LKKKTGPPAVEVT 435
           +   + P   E+T
Sbjct: 384 INIVSSPFITELT 396


>SPBC4B4.11 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 113

 Score = 29.9 bits (64), Expect = 0.35
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = -1

Query: 558 LGHQQLEQLKGKFWLWLALVRKETKYNNSIGID 460
           +G    E++ GKF  W  L RK TK     GID
Sbjct: 43  IGRDTAEKVNGKFESWDGLFRKSTKTMKKEGID 75


>SPBC3D6.13c |||protein disulfide isomerase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 726

 Score = 29.1 bits (62), Expect = 0.61
 Identities = 15/84 (17%), Positives = 38/84 (45%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435
           +A ++    +   + Y ++ +PT  FF+  + ++Y G     D++S+ ++       EV 
Sbjct: 333 VAHINCAVSKRACKQYSIQYFPTFLFFKEEAFVEYVGLPNEGDLVSFAEEAANFEIREVE 392

Query: 436 SAEQAKELIDANTVIVFGFFSDQS 507
             +      + +   ++ F+ D S
Sbjct: 393 LLDTVNAEKNGDVFFLY-FYDDDS 415



 Score = 28.3 bits (60), Expect = 1.1
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +2

Query: 158 VEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           +++Y P CG CK L P +     K  E+
Sbjct: 47  IKYYLPSCGACKRLGPMWDNMVEKAKEQ 74


>SPBC26H8.06 |grx4||glutaredoxin Grx4|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 244

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +2

Query: 146 EYILVEFYAPWCGHCKSL 199
           + IL+ FYAPW   CK +
Sbjct: 21  QIILLNFYAPWAAPCKQM 38


>SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit
           Srb9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1223

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 14/41 (34%), Positives = 19/41 (46%)
 Frame = +3

Query: 93  KMCSF*VKLTLKL*LQPRSTF*LNSMLHGAATANLWHRNTP 215
           K  +F       L LQP  T   N +L+   + NLW R+ P
Sbjct: 620 KSANFDFSFLKSLDLQPTITLGKNDLLNAILSQNLWFRSLP 660


>SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 462

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 5/38 (13%)
 Frame = -3

Query: 265 LSLVDRRFFFSQLCCCLGVF-----RCQRFAVAAPWSI 167
           L ++D  F  S L  C  +      RC R  V  PW++
Sbjct: 68  LFVLDTNFLLSHLSLCQNLIEFLTARCPRLVVVLPWTV 105


>SPCC330.08 |alg11|gmd3|alpha-1,2-mannosyltransferase
           Alg11|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 471

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = +1

Query: 352 IDYSGGRQADDIISWLKKKTGPPAVEVTSAEQA 450
           ++ SGG + D +I W+ K TG  A  ++   +A
Sbjct: 389 VNNSGGPKFDIVIPWIGKPTGFHASTISEYAEA 421


>SPCC306.03c |cnd2||condensin subunit Cnd2|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 742

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = -1

Query: 453 FSLFSRGDLNSRGASLLLQPTDDVISLTTT*IVDRT 346
           F   S+G+L+    SLL   +D+V  +TTT +VD T
Sbjct: 304 FEFDSKGNLD---VSLLKSLSDEVNMITTTSLVDNT 336


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,559,287
Number of Sequences: 5004
Number of extensions: 48806
Number of successful extensions: 145
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 125
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 144
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 307866294
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -