SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30112.Seq
         (446 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC8D2.07c |sfc9||transcription factor TFIIIC complex subunit S...    30   0.19 
SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe...    28   0.57 
SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual    27   0.99 
SPBP23A10.14c |ell1||RNA polymerase II transcription elongation ...    27   1.3  
SPBC16H5.12c |||conserved fungal protein|Schizosaccharomyces pom...    27   1.3  
SPAC23C11.17 |||mitochondrial inner membrane protein involved in...    26   3.0  
SPBC14F5.11c |mug186||sorting nexin Snx41|Schizosaccharomyces po...    26   3.0  
SPCC126.03 |pus1|SPCC126.03, SPCC126.03|tRNA pseudouridylate syn...    26   3.0  
SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18 |Sch...    25   4.0  
SPBC19F8.03c |||clathrin binding protein|Schizosaccharomyces pom...    25   4.0  
SPAC2H10.02c |||26S proteasome regulator |Schizosaccharomyces po...    25   5.3  
SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch...    25   5.3  
SPCC16C4.06c |||tRNA pseudouridylate synthase |Schizosaccharomyc...    25   5.3  
SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch...    25   7.0  
SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion ...    25   7.0  
SPAC23C11.16 |plo1||Polo kinase Plo1|Schizosaccharomyces pombe|c...    25   7.0  
SPAC144.16 |||DUF59 family protein|Schizosaccharomyces pombe|chr...    24   9.3  
SPAC5D6.13 ||SPAPJ735.02c|Golgi phosphoprotein 3 family|Schizosa...    24   9.3  

>SPBC8D2.07c |sfc9||transcription factor TFIIIC complex subunit Sfc9
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 673

 Score = 29.9 bits (64), Expect = 0.19
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = -1

Query: 296 CSSLSRNILRRASDSGLXYGHSVTAFDSVFLLLRTESSS 180
           CS L+ N+L   S SG+ +GH+    D++++ + T S +
Sbjct: 293 CSFLNHNLLSLCSPSGVLFGHN--DIDTIYVYILTHSGT 329


>SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 488

 Score = 28.3 bits (60), Expect = 0.57
 Identities = 14/51 (27%), Positives = 24/51 (47%)
 Frame = -1

Query: 314 HISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLLRTESSSGSDIRW 162
           H +++ C S +R++L   S SG  + H V   +     L+  SS    + W
Sbjct: 262 HQARVGCLSWNRHVLSSGSRSGAIHHHDVRIANHQIGTLQGHSSEVCGLAW 312


>SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1236

 Score = 27.5 bits (58), Expect = 0.99
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = -1

Query: 254 SGLXYGHSVTAFDSVFLLLRTESSSGSDIRWTVLSHSTQTTFPAA 120
           SG+      + F SV  +L + +SS S    ++ S ST +TF +A
Sbjct: 562 SGISSSSIPSTFSSVSSILSSSTSSPSSTSLSISSSSTSSTFSSA 606


>SPBP23A10.14c |ell1||RNA polymerase II transcription elongation
           factor SpELL|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 533

 Score = 27.1 bits (57), Expect = 1.3
 Identities = 20/71 (28%), Positives = 34/71 (47%)
 Frame = -2

Query: 289 AFRETFSAVLPTLVSXTDTP*QHSIPSFCCLGQSPVLALISDGQSSATVHKPPSLRHGSS 110
           +F +T S  +P++ S +    QH IP       SP+L+  S  ++S  +      R GS 
Sbjct: 321 SFIDTNSPSMPSISSVSSYQQQHRIPKLNASNYSPLLSPSSHRKTSGNLS-----RTGSE 375

Query: 109 CSMESISQKSS 77
            S  S+S  ++
Sbjct: 376 SSAVSLSDTTN 386


>SPBC16H5.12c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 682

 Score = 27.1 bits (57), Expect = 1.3
 Identities = 22/75 (29%), Positives = 31/75 (41%)
 Frame = +3

Query: 117 PCRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCYGVSVXETRVGSTAENVSRKATA 296
           P  REG L  +A  C +D+    GL            YG S  E  V  + E+  +K +A
Sbjct: 208 PIGREGVLSQLATACQADLTLSAGL---------HFRYGASYNEFCVNHSPEHYLQKLSA 258

Query: 297 VNL*YMKKLQTVPKE 341
               +M+   TV  E
Sbjct: 259 ARAQFMEVYDTVKAE 273


>SPAC23C11.17 |||mitochondrial inner membrane protein involved in
           potassium ion transport|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 485

 Score = 25.8 bits (54), Expect = 3.0
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = -3

Query: 147 QYTNHLPCGTDPLVQWNLFHR 85
           +Y N    GTDPL+++N+ HR
Sbjct: 295 RYMNLNAFGTDPLLRYNIRHR 315


>SPBC14F5.11c |mug186||sorting nexin Snx41|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 586

 Score = 25.8 bits (54), Expect = 3.0
 Identities = 15/46 (32%), Positives = 19/46 (41%)
 Frame = -2

Query: 214 PSFCCLGQSPVLALISDGQSSATVHKPPSLRHGSSCSMESISQKSS 77
           PS   +G    L    DG    T      LRH  S   E++SQ +S
Sbjct: 426 PSVPLMGTDQPLENYHDGNGEQTEECLRDLRHNQSQDFETVSQDTS 471


>SPCC126.03 |pus1|SPCC126.03, SPCC126.03|tRNA pseudouridylate
           synthase Lsp1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 534

 Score = 25.8 bits (54), Expect = 3.0
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 279 KHSPPCFRLWSLXRTLRNSIRFRLF 205
           +H PP  RLW + RT+ NS   R +
Sbjct: 130 EHLPPSIRLWDVIRTI-NSFNPRTY 153


>SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1316

 Score = 25.4 bits (53), Expect = 4.0
 Identities = 17/72 (23%), Positives = 33/72 (45%)
 Frame = -2

Query: 280 ETFSAVLPTLVSXTDTP*QHSIPSFCCLGQSPVLALISDGQSSATVHKPPSLRHGSSCSM 101
           E F+ V P+ VS  +    H I  F      P+ A   D  +S +VH+  +    ++   
Sbjct: 422 EPFNTVKPS-VSPEEV---HDISQFNHRNDPPITAASVDSSNSFSVHRSSTNHSSTNSGS 477

Query: 100 ESISQKSSSLFP 65
            ++S++++   P
Sbjct: 478 PNLSRRNNLAIP 489


>SPBC19F8.03c |||clathrin binding protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 649

 Score = 25.4 bits (53), Expect = 4.0
 Identities = 12/36 (33%), Positives = 15/36 (41%)
 Frame = -2

Query: 190 SPVLALISDGQSSATVHKPPSLRHGSSCSMESISQK 83
           SP   +  +G      H P    HG S S  +I QK
Sbjct: 569 SPAHIMYPEGSPGFIQHSPNGFTHGHSASPVNIGQK 604


>SPAC2H10.02c |||26S proteasome regulator |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 213

 Score = 25.0 bits (52), Expect = 5.3
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +3

Query: 84  FCEIDSIEQEDPCRREGGLC 143
           FC +DS+  E P  +E GLC
Sbjct: 129 FCVVDSVAVESPA-QEAGLC 147


>SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 845

 Score = 25.0 bits (52), Expect = 5.3
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -3

Query: 282 EKHSPPCFRLWSLXRTLRNSIRFRLFAA 199
           E   P C   ++L  T R+S RFRLF A
Sbjct: 335 ETTPPSCEVSYNLLLTCRSSNRFRLFPA 362


>SPCC16C4.06c |||tRNA pseudouridylate synthase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 413

 Score = 25.0 bits (52), Expect = 5.3
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = -3

Query: 270 PPCFRLWSLXRTLRN 226
           PPC R+W + RT  +
Sbjct: 128 PPCIRVWKMARTFNS 142


>SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion
           cytochrome c oxidase assembly protein Cox1101,
           mitochondrial ribosomal protein
           Rsm22|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 753

 Score = 24.6 bits (51), Expect = 7.0
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +3

Query: 117 PCRREGGLCTVAEDCPSDIRARTGLCPKQQ 206
           P +R+G +  + + C SD R R  + PK Q
Sbjct: 418 PLKRDGHV--IIDVCDSDARLRRNIVPKSQ 445


>SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion
           cytochrome c oxidase assembly protein Cox1102,
           mitochondrial ribosomal protein
           Rsm2202|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 753

 Score = 24.6 bits (51), Expect = 7.0
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +3

Query: 117 PCRREGGLCTVAEDCPSDIRARTGLCPKQQ 206
           P +R+G +  + + C SD R R  + PK Q
Sbjct: 418 PLKRDGHV--IIDVCDSDARLRRNIVPKSQ 445


>SPAC23C11.16 |plo1||Polo kinase Plo1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 683

 Score = 24.6 bits (51), Expect = 7.0
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -1

Query: 293 SSLSRNILRRASDSGLXYGHSVTAFDSVFLLLRTESSSGSDIRWTVLS 150
           SS  RN+   AS SG+ +G+S     +    LRT+      I  +VLS
Sbjct: 323 SSFQRNLDFVASASGVGFGNSAGVEKNKPYALRTDEVDNDRILPSVLS 370


>SPAC144.16 |||DUF59 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 179

 Score = 24.2 bits (50), Expect = 9.3
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = -2

Query: 166 DGQSSATVHKPPSLRHGSSCSM 101
           +G S  TVH  P++ H S C++
Sbjct: 93  EGDSYITVHITPTIPHCSMCTL 114


>SPAC5D6.13 ||SPAPJ735.02c|Golgi phosphoprotein 3
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 337

 Score = 24.2 bits (50), Expect = 9.3
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = -1

Query: 329 SLKLLHISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLL 198
           S + L    + CSS + N+L  A D+ L Y     AF  V  LL
Sbjct: 239 SFRCLRTVALACSSYAANVLENALDN-LNYEDREKAFSRVDELL 281


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,646,655
Number of Sequences: 5004
Number of extensions: 32515
Number of successful extensions: 120
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 117
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 120
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 164204010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -