SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30111.Seq
         (593 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC12D12.03 |cct1||chaperonin-containing T-complex alpha subuni...   128   6e-31
SPAC1D4.04 |cct2||chaperonin-containing T-complex beta subunit C...    84   2e-17
SPBC1A4.08c |cct3||chaperonin-containing T-complex gamma subunit...    83   3e-17
SPAC1420.02c |cct5||chaperonin-containing T-complex epsilon subu...    80   3e-16
SPBC106.06 |cct4||chaperonin-containing T-complex delta subunit ...    75   8e-15
SPBC25H2.12c |cct7||chaperonin-containing T-complex eta subunit ...    73   4e-14
SPBC646.11 |cct6||chaperonin-containing T-complex zeta subunit C...    62   8e-11
SPBC337.05c |cct8||chaperonin-containing T-complex theta subunit...    62   8e-11
SPAC12G12.04 |hsp60|hsp60|mitochondrial heat shock protein Hsp60...    37   0.003
SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces po...    27   2.1  
SPBC8E4.01c ||SPBP4G3.01|inorganic phosphate transporter |Schizo...    27   2.7  
SPBC1683.01 |||inorganic phosphate transporter |Schizosaccharomy...    27   2.7  
SPAC23D3.12 |||inorganic phosphate transporter |Schizosaccharomy...    26   4.8  
SPAC13G6.06c |||glycine cleavage complex subunit P|Schizosacchar...    25   6.3  
SPCC18.09c |||conserved eukaryotic protein|Schizosaccharomyces p...    25   8.3  

>SPBC12D12.03 |cct1||chaperonin-containing T-complex alpha subunit
           Cct1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 556

 Score =  128 bits (309), Expect = 6e-31
 Identities = 63/89 (70%), Positives = 77/89 (86%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           ++VEHPA KVLVELAQ QD+EVGDGTTSVVIIAAELL+ A+ELVK KIHPT+II+GYRLA
Sbjct: 70  LDVEHPAGKVLVELAQQQDKEVGDGTTSVVIIAAELLRRANELVKNKIHPTTIITGYRLA 129

Query: 434 CKEAVKYIQDNLTVTVESLGRPSLITQPK 520
            +EAVK++ D L+ +V+SLG+ SLI   K
Sbjct: 130 IREAVKFMTDVLSCSVDSLGKESLINVAK 158



 Score = 82.6 bits (195), Expect = 4e-17
 Identities = 39/60 (65%), Positives = 47/60 (78%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           L ++G +  G+ VR QNV+      N+VKSSLGPVGLDKMLVDDIGDVTVTN+GATIL +
Sbjct: 10  LFLSGEKISGEDVRNQNVLATTAIANVVKSSLGPVGLDKMLVDDIGDVTVTNDGATILSL 69



 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 18/26 (69%), Positives = 22/26 (84%)
 Frame = +1

Query: 508 HTAKTTMSSKLIGADADFFSEMVVDA 585
           + AKT+MSSK+IG D+DFFS M VDA
Sbjct: 155 NVAKTSMSSKIIGNDSDFFSTMAVDA 180


>SPAC1D4.04 |cct2||chaperonin-containing T-complex beta subunit
           Cct2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 527

 Score = 83.8 bits (198), Expect = 2e-17
 Identities = 37/68 (54%), Positives = 54/68 (79%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ +++ AAKVLV ++++QD+EVGDGTTSV + AAELL+ A+ +V  KIHP  II GY
Sbjct: 67  LKSIALDNAAAKVLVNISKVQDDEVGDGTTSVCVFAAELLRQAEIMVNAKIHPQVIIDGY 126

Query: 425 RLACKEAV 448
           R+A K A+
Sbjct: 127 RIATKTAI 134



 Score = 48.8 bits (111), Expect = 6e-07
 Identities = 24/57 (42%), Positives = 37/57 (64%), Gaps = 1/57 (1%)
 Frame = +3

Query: 84  AGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKML-VDDIGDVTVTNEGATILK 251
           +G +  G+  R  + +      ++VKS+LGP G+DK+L  +  GD+ VTN+GATILK
Sbjct: 12  SGIQERGENARLSSFVGAIAVGDLVKSTLGPKGMDKILQSNSSGDIVVTNDGATILK 68



 Score = 29.1 bits (62), Expect = 0.51
 Identities = 11/39 (28%), Positives = 27/39 (69%)
 Frame = +1

Query: 469 HSNSRVTWQAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +S+    +++  ++ A+TT+SSK++  + + F+++ VDA
Sbjct: 144 NSSDPAKFRSDLENIARTTLSSKILSQNKNHFAQLAVDA 182


>SPBC1A4.08c |cct3||chaperonin-containing T-complex gamma subunit
           Cct3|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 528

 Score = 83.0 bits (196), Expect = 3e-17
 Identities = 39/79 (49%), Positives = 57/79 (72%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EV HPAAK ++ELA+ QDEEVGDGTTSV+I+A E+L  A  L+  KIHP  +I  +
Sbjct: 65  LREIEVAHPAAKSMIELARTQDEEVGDGTTSVIILAGEILAAASPLLDRKIHPVVMIRSF 124

Query: 425 RLACKEAVKYIQDNLTVTV 481
           + A ++A+  I D +T+ V
Sbjct: 125 KQALEDALSII-DEITLPV 142



 Score = 44.0 bits (99), Expect = 2e-05
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           ++  G R  G   +  N+       +++++ LGP  + KML+D +G V +TN+G  IL+
Sbjct: 8   MNTNGNRQVGHKAQMSNIQAAKAVADVIRTCLGPRAMLKMLLDPVGSVLLTNDGHAILR 66


>SPAC1420.02c |cct5||chaperonin-containing T-complex epsilon subunit
           Cct5|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 546

 Score = 79.8 bits (188), Expect = 3e-16
 Identities = 35/71 (49%), Positives = 51/71 (71%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  +EVEH  AK+LV+L++ QD+E+GDGTT VV++A  LL+ A+ L+   IHP  I  GY
Sbjct: 80  LDQMEVEHQIAKLLVQLSKSQDDEIGDGTTGVVVLAGALLEQAEALIDKGIHPIRIADGY 139

Query: 425 RLACKEAVKYI 457
             AC+ AVK++
Sbjct: 140 EKACQVAVKHL 150



 Score = 51.2 bits (117), Expect = 1e-07
 Identities = 24/48 (50%), Positives = 36/48 (75%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           D V++ +++      NIV++SLGP GLDK+L+   G++TVTN+GATIL
Sbjct: 34  DAVKS-HILATKTVANIVRTSLGPRGLDKILISPDGEITVTNDGATIL 80



 Score = 25.4 bits (53), Expect = 6.3
 Identities = 10/25 (40%), Positives = 17/25 (68%)
 Frame = +1

Query: 511 TAKTTMSSKLIGADADFFSEMVVDA 585
           +AKT++ SK++    D F+ + VDA
Sbjct: 170 SAKTSLGSKVVSKAHDHFANIAVDA 194


>SPBC106.06 |cct4||chaperonin-containing T-complex delta subunit
           Cct4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 527

 Score = 74.9 bits (176), Expect = 8e-15
 Identities = 39/88 (44%), Positives = 58/88 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ V HPAAK+LV+L+  QD E GDGTTSVVI+A  +L  A++L+K  IHPT I   +
Sbjct: 65  LKHLSVLHPAAKMLVDLSAAQDVEAGDGTTSVVILAGSMLACAEKLLKKGIHPTVIAESF 124

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           + A    V  +++N  + +E   R SL+
Sbjct: 125 QRAAGFTVDCMKEN-ALAIELSDRESLL 151



 Score = 49.6 bits (113), Expect = 3e-07
 Identities = 22/47 (46%), Positives = 32/47 (68%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           VR  N+M      + +++SLGP G+DKM+    G+V +TN+GATILK
Sbjct: 20  VRLSNIMAARSVADAIRTSLGPKGMDKMIQTGKGEVILTNDGATILK 66


>SPBC25H2.12c |cct7||chaperonin-containing T-complex eta subunit
           Cct7|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 558

 Score = 72.5 bits (170), Expect = 4e-14
 Identities = 36/73 (49%), Positives = 50/73 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++ HPAAK LV++A+ QD EVGDGTTSVV+ A ELL+ A   V+  +    II GY
Sbjct: 70  MKLLDIVHPAAKTLVDIARAQDAEVGDGTTSVVVFAGELLREARTFVEDGVSSHLIIRGY 129

Query: 425 RLACKEAVKYIQD 463
           R A + AV  I++
Sbjct: 130 RKAAQLAVNKIKE 142



 Score = 48.8 bits (111), Expect = 6e-07
 Identities = 18/44 (40%), Positives = 33/44 (75%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           N+       + ++++LGP+G DK++VDD G+V ++N+GATI+K+
Sbjct: 29  NINACVAVQDTIRTTLGPLGADKLMVDDRGEVVISNDGATIMKL 72



 Score = 31.9 bits (69), Expect = 0.073
 Identities = 14/24 (58%), Positives = 20/24 (83%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A T M+SKLI +++ FF++MVVDA
Sbjct: 163 ASTAMNSKLIRSNSTFFTKMVVDA 186


>SPBC646.11 |cct6||chaperonin-containing T-complex zeta subunit
           Cct6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 535

 Score = 61.7 bits (143), Expect = 8e-11
 Identities = 25/71 (35%), Positives = 45/71 (63%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  +++++P A  + + A  QD+  GDGTTSV ++  ELLK A+  ++  +HP+ I  G+
Sbjct: 62  LTEMQIQNPTASCIAKAATAQDDATGDGTTSVCLLVGELLKQAELYIREGLHPSLISDGF 121

Query: 425 RLACKEAVKYI 457
            LA  EA+ ++
Sbjct: 122 NLAKNEALTFL 132



 Score = 38.3 bits (85), Expect = 8e-04
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       +++KS+LGP G  KMLVD  G + +T +G  +L
Sbjct: 21  NISAAIGLQDVLKSNLGPTGTTKMLVDGAGAIKLTKDGKVLL 62


>SPBC337.05c |cct8||chaperonin-containing T-complex theta subunit
           Cct8 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 546

 Score = 61.7 bits (143), Expect = 8e-11
 Identities = 26/82 (31%), Positives = 48/82 (58%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           I+ +EV HPAAK++V+  Q Q+ E+GD    VV+   ELL  A+ +++  + P  I  GY
Sbjct: 72  IRELEVIHPAAKLVVDATQQQENELGDAANFVVVFTGELLAKAENMIRMGLTPLEIAKGY 131

Query: 425 RLACKEAVKYIQDNLTVTVESL 490
            +A    ++ +++     +E++
Sbjct: 132 EMALSHTMEVLEEICADKIETV 153



 Score = 32.3 bits (70), Expect = 0.055
 Identities = 13/33 (39%), Positives = 24/33 (72%)
 Frame = +3

Query: 153 IVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           I ++SLGP G +K++V+ +    +TN+ ATI++
Sbjct: 41  ITRTSLGPNGKNKIVVNHLQQTFLTNDAATIIR 73


>SPAC12G12.04 |hsp60|hsp60|mitochondrial heat shock protein
           Hsp60|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 582

 Score = 36.7 bits (81), Expect = 0.003
 Identities = 17/68 (25%), Positives = 34/68 (50%)
 Frame = +2

Query: 263 EHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKE 442
           E+  A+++ ++A   +E  GDGTT+  ++   +       V    +P  +  G +LA   
Sbjct: 98  ENLGARLVQDVASKTNEVAGDGTTTATVLTRAIFSETVRNVAAGCNPMDLRRGIQLAVDN 157

Query: 443 AVKYIQDN 466
            V+++Q N
Sbjct: 158 VVEFLQAN 165


>SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 897

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 10/31 (32%), Positives = 20/31 (64%)
 Frame = +2

Query: 332 TSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           T++++++  LL    E + TK+HP+  +S Y
Sbjct: 302 TNLIVVSVALLHQWAEELSTKVHPSKKLSVY 332


>SPBC8E4.01c ||SPBP4G3.01|inorganic phosphate transporter
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 572

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 7/18 (38%), Positives = 14/18 (77%)
 Frame = +1

Query: 163 APLGQLVWIRCWLTILGM 216
           +PL +++W+ CW  +LG+
Sbjct: 149 SPLSKMMWVFCWRWLLGV 166


>SPBC1683.01 |||inorganic phosphate transporter |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 573

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 7/18 (38%), Positives = 14/18 (77%)
 Frame = +1

Query: 163 APLGQLVWIRCWLTILGM 216
           +PL +++W+ CW  +LG+
Sbjct: 149 SPLSKMMWVFCWRWLLGV 166


>SPAC23D3.12 |||inorganic phosphate transporter |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 559

 Score = 25.8 bits (54), Expect = 4.8
 Identities = 8/17 (47%), Positives = 13/17 (76%)
 Frame = +1

Query: 166 PLGQLVWIRCWLTILGM 216
           PLG+++WI  W  +LG+
Sbjct: 145 PLGKMMWIFAWRWLLGL 161


>SPAC13G6.06c |||glycine cleavage complex subunit
           P|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1017

 Score = 25.4 bits (53), Expect = 6.3
 Identities = 17/59 (28%), Positives = 26/59 (44%)
 Frame = +2

Query: 296 AQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKYIQDNLT 472
           A L DE    G   V+++A +  K    LV   I+P ++      A    +K   DN+T
Sbjct: 192 ASLLDEGTAAGEAMVMLMANDKKKRKTFLVDKNIYPNTLSVLRTRASGFGIKIELDNIT 250


>SPCC18.09c |||conserved eukaryotic protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 232

 Score = 25.0 bits (52), Expect = 8.3
 Identities = 12/42 (28%), Positives = 21/42 (50%)
 Frame = +2

Query: 389 TKIHPTSIISGYRLACKEAVKYIQDNLTVTVESLGRPSLITQ 514
           T +HP  I+  +R   ++ V Y+Q +L+  +    R  L  Q
Sbjct: 82  THVHPLEIMMKHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQ 123


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,327,939
Number of Sequences: 5004
Number of extensions: 43602
Number of successful extensions: 125
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 110
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 124
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 258201856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -