SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30108.Seq
         (591 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1105.14 |rsv2||transcription factor Rsv2|Schizosaccharomyces...    30   0.29 
SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos...    26   3.6  

>SPBC1105.14 |rsv2||transcription factor Rsv2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 637

 Score = 29.9 bits (64), Expect = 0.29
 Identities = 12/49 (24%), Positives = 29/49 (59%)
 Frame = +1

Query: 430 ITQTIKTSSSSACISPLLDVNLSHSPHNARSSTFRIQFFPAYCHKSSAH 576
           +T  +KTS++   + P  +++ S++PH+  ++T  +    +Y +  S+H
Sbjct: 467 LTSPVKTSANIPNLLPTSELDSSNAPHSQSAATHDLNDVKSYYNTRSSH 515


>SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm
           type|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 473

 Score = 26.2 bits (55), Expect = 3.6
 Identities = 11/31 (35%), Positives = 14/31 (45%)
 Frame = -1

Query: 237 SRYNQCNQVQQCRNPTILCIQGISFFHFNDE 145
           SRYN C   +   +P     +G  F  F DE
Sbjct: 208 SRYNSCKSAKIMTDPQTNVSRGYGFVRFTDE 238


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,558,765
Number of Sequences: 5004
Number of extensions: 53096
Number of successful extensions: 142
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 137
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 142
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 256184654
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -