SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30107.Seq
         (684 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1919.11 |mug137||BAR adaptor protein|Schizosaccharomyces pom...    30   0.36 
SPBC651.01c |nog1|SPBC725.18c|GTP binding protein Nog1 |Schizosa...    29   0.83 
SPAC1687.11 |spb1||rRNA methyltransferase Spb1 |Schizosaccharomy...    27   2.5  
SPAC23C11.03 |||U3 snoRNP-associated protein Mpp1 |Schizosacchar...    26   5.8  
SPCC1183.11 ||SPCC31H12.01|MS ion channel protein 1|Schizosaccha...    26   5.8  

>SPCC1919.11 |mug137||BAR adaptor protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 420

 Score = 29.9 bits (64), Expect = 0.36
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +2

Query: 287 TVPTRKGIKETQNVKSXTSKVENNRRVRDLHARSIVMLSVRL 412
           + P RK  KET  VK+  S    N +  DLH   ++ +S +L
Sbjct: 271 STPKRKSKKETVFVKAIYSFTGRNEKELDLHTGDVIQVSEQL 312


>SPBC651.01c |nog1|SPBC725.18c|GTP binding protein Nog1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 642

 Score = 28.7 bits (61), Expect = 0.83
 Identities = 24/83 (28%), Positives = 37/83 (44%)
 Frame = +2

Query: 188 VKSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRV 367
           ++SA     + +E  RSR R  +  E     GV +   +G  E    KS   + ++NRR 
Sbjct: 528 LQSAGLPSDSIEERARSRARTAAANEMADGSGVDLLMNEG--EEIRSKSIAPRSQSNRRE 585

Query: 368 RDLHARSIVMLSVRLRVVVKIGR 436
             +HA      + RL  V +I R
Sbjct: 586 SGVHAEGARSYADRLARVKQIHR 608


>SPAC1687.11 |spb1||rRNA methyltransferase Spb1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 802

 Score = 27.1 bits (57), Expect = 2.5
 Identities = 16/59 (27%), Positives = 28/59 (47%)
 Frame = +2

Query: 209 EGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVRDLHAR 385
           E A++  +   +  +SKP+ KP   V     KG+K          K+ ++R  +DL A+
Sbjct: 735 EKAKEISRLVSRATKSKPKAKPTLVVAKGPNKGLKSRPKGVKGKYKMVDSRMKKDLRAQ 793


>SPAC23C11.03 |||U3 snoRNP-associated protein Mpp1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 598

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 17/57 (29%), Positives = 25/57 (43%)
 Frame = +2

Query: 245 REQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVRDLHARSIVMLSVRLR 415
           +E  KP  +  +G T+ TR GI  +        K    RRVR  HA     ++ + R
Sbjct: 497 QEVYKPSNENREGETI-TRSGIAISSTEMDHQQKQARRRRVRRKHAEKRKQMAEKRR 552


>SPCC1183.11 ||SPCC31H12.01|MS ion channel protein
           1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1011

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 8/104 (7%)
 Frame = +2

Query: 191 KSARAGEGAQKED-QRSRKREQSKPEPKPAKG----VTVPTRKGIKETQNVKSXTSKVEN 355
           KS R  +  +  D +R+ + E++  E +        VT  T   IK   +  +   ++  
Sbjct: 153 KSMRTSKSKKSGDYERTAENEEAAQEAENHLDNFGVVTFGTEAPIKAPDHPVTIFGRIFK 212

Query: 356 NRRVRDLHARS---IVMLSVRLRVVVKIGRRTVPQKXGRSSAGH 478
             + R  + RS   I+ L V L + V IGR   PQ   R   GH
Sbjct: 213 FIQQRSFYLRSLIYIIPLGVLLLIPVFIGRFYHPQPPYRDELGH 256


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,172,593
Number of Sequences: 5004
Number of extensions: 33423
Number of successful extensions: 91
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 87
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 90
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 315915086
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -