SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30104.Seq
         (674 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC2G5.01 |||DUF1682 family protein|Schizosaccharomyces pombe|c...    27   3.3  
SPAC5D6.09c |mug86||acetate transporter |Schizosaccharomyces pom...    26   4.3  
SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr...    25   7.6  
SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha...    25   7.6  
SPAC25H1.06 |||histone acetyltransferase complex subunit |Schizo...    25   10.0 
SPBP4H10.04 |ppb1||calcineurin catalytic subunit Ppb1|Schizosacc...    25   10.0 

>SPBC2G5.01 |||DUF1682 family protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 374

 Score = 26.6 bits (56), Expect = 3.3
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = -2

Query: 139 TGLRRCIKNLAAYILIKFPSIPQSKNKLYL 50
           + +  CI+NL  +I+   PS+P +  K Y+
Sbjct: 236 SSINECIENLEYFIVTDQPSVPPATEKDYV 265


>SPAC5D6.09c |mug86||acetate transporter |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 304

 Score = 26.2 bits (55), Expect = 4.3
 Identities = 9/12 (75%), Positives = 11/12 (91%)
 Frame = +2

Query: 527 FWLSYAPIYIPY 562
           FWLSYA I+IP+
Sbjct: 161 FWLSYASIFIPW 172


>SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 697

 Score = 25.4 bits (53), Expect = 7.6
 Identities = 8/15 (53%), Positives = 14/15 (93%)
 Frame = +2

Query: 497 HSPREIILWNFWLSY 541
           +SP+E+I +N+WLS+
Sbjct: 182 NSPKELIDYNYWLSW 196


>SPAC4F8.11 |||WD repeat protein, human WDR24
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 846

 Score = 25.4 bits (53), Expect = 7.6
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 4/66 (6%)
 Frame = +3

Query: 57  NLFFDCGMLGNL----INMYAAKFLIHRRSPVFLLNRVSITTKKKVHDPSEEELLPIFQY 224
           NL F C  LGNL    +N+ A  +  +  S       +S      V   S++ L+ ++ Y
Sbjct: 105 NLIFTCSPLGNLNVWDVNLEALLYDFNEHSRAVHKLDISSFHPSYVLTASQDGLIKLWDY 164

Query: 225 PISKST 242
             S ST
Sbjct: 165 KESSST 170


>SPAC25H1.06 |||histone acetyltransferase complex subunit
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 408

 Score = 25.0 bits (52), Expect = 10.0
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%)
 Frame = +3

Query: 405 VATVSQ*PQ*KLQSSTKF-SVPVSIQIPKLDTIHHEKSSFGTS 530
           +AT+S      +   TK+ S+P    +P +  I H+K  FG S
Sbjct: 147 IATMSSCGNAYIFDRTKYTSMPAEEFLPNISLIGHKKEGFGLS 189


>SPBP4H10.04 |ppb1||calcineurin catalytic subunit
           Ppb1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 554

 Score = 25.0 bits (52), Expect = 10.0
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = -2

Query: 376 CKRRPHWMPNQFEVVFVTFFPFL 308
           C   P+W+PN F  VF    PF+
Sbjct: 365 CSPHPYWLPN-FMDVFTWSLPFV 386


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,863,017
Number of Sequences: 5004
Number of extensions: 58559
Number of successful extensions: 138
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 135
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 138
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 309878492
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -