SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30102.Seq
         (594 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC5D6.01 |rps2202|rps22-2, rps15a-2|40S ribosomal protein S15a...   103   2e-23
SPAC22A12.04c |rps2201|rps22-1, rps15a-1|40S ribosomal protein S...   103   2e-23
SPAC3F10.13 |ucp6||UBA domain protein Ucp6|Schizosaccharomyces p...    27   2.7  
SPBC3B9.16c |nup120||nucleoporin Nup120|Schizosaccharomyces pomb...    26   3.6  

>SPAC5D6.01 |rps2202|rps22-2, rps15a-2|40S ribosomal protein
           S15a|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 130

 Score =  103 bits (247), Expect = 2e-23
 Identities = 48/69 (69%), Positives = 57/69 (82%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR +VL+D L +I NAE+RG+RQVLIRP SKVIVKFLTVM  HGYI EF  +DDHR+GK
Sbjct: 1   MVRQSVLADCLNNIVNAERRGRRQVLIRPSSKVIVKFLTVMQKHGYIDEFTEIDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IV+ L GR+
Sbjct: 61  IVIQLNGRI 69



 Score = 70.1 bits (164), Expect = 2e-13
 Identities = 33/47 (70%), Positives = 37/47 (78%), Gaps = 1/47 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEAR 117
           KCGVISPRF+V + DIE+W N LLPSRQ G +VL TS GIM H EAR
Sbjct: 71  KCGVISPRFNVKLKDIEKWVNQLLPSRQVGVIVLTTSRGIMSHNEAR 117


>SPAC22A12.04c |rps2201|rps22-1, rps15a-1|40S ribosomal protein
           S15a|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 130

 Score =  103 bits (247), Expect = 2e-23
 Identities = 48/69 (69%), Positives = 57/69 (82%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR +VL+D L +I NAE+RG+RQVLIRP SKVIVKFLTVM  HGYI EF  +DDHR+GK
Sbjct: 1   MVRQSVLADCLNNIVNAERRGRRQVLIRPSSKVIVKFLTVMQKHGYIDEFTEIDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IV+ L GR+
Sbjct: 61  IVIQLNGRI 69



 Score = 70.1 bits (164), Expect = 2e-13
 Identities = 33/47 (70%), Positives = 37/47 (78%), Gaps = 1/47 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEAR 117
           KCGVISPRF+V + DIE+W N LLPSRQ G +VL TS GIM H EAR
Sbjct: 71  KCGVISPRFNVKLKDIEKWVNQLLPSRQVGVIVLTTSRGIMSHNEAR 117


>SPAC3F10.13 |ucp6||UBA domain protein Ucp6|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 612

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 12/45 (26%), Positives = 19/45 (42%)
 Frame = +1

Query: 460 PWLRFSSRFVANRIXRGARYPIRPIVSRITIHWPSFYNVVTGKTL 594
           P +  S   + NR     RY +  +  +  + W   Y  +TG TL
Sbjct: 326 PKIDLSKCIIENRDEMLRRYQLETVYRKTLLEWEDLYKRLTGVTL 370


>SPBC3B9.16c |nup120||nucleoporin Nup120|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1136

 Score = 26.2 bits (55), Expect = 3.6
 Identities = 10/31 (32%), Positives = 20/31 (64%)
 Frame = -3

Query: 277 VNLTGRLKSVVSFHLVLMFPSTILKDGLICS 185
           V+L  + + +  F++ + FPS ++KDG+  S
Sbjct: 88  VSLNSKKEPLSKFNVKIHFPSNVMKDGVAFS 118


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,931,217
Number of Sequences: 5004
Number of extensions: 34193
Number of successful extensions: 79
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 75
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 77
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 258201856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -