SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30099.Seq
         (730 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha Ef...   180   1e-46
SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha Ef...   180   2e-46
SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha Ef...   180   2e-46
SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa...   106   4e-24
SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related prote...   100   2e-22
SPBC9B6.04c |tuf1||mitochondrial translation elongation factor E...    78   1e-15
SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma su...    37   0.003
SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac...    36   0.008
SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon...    36   0.008
SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schiz...    34   0.018
SPBC1271.15c |||translation initiation factor IF-2Mt|Schizosacch...    33   0.032
SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr 3|||Ma...    30   0.29 
SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces po...    30   0.39 
SPAC56F8.03 |||translation initiation factor IF2 |Schizosaccharo...    29   0.51 
SPBC405.01 |ade1|min4, SPBC4C3.02c|phosphoribosylamine-glycine l...    29   0.68 
SPBC660.10 |||translation elongation factor G|Schizosaccharomyce...    29   0.68 
SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizo...    27   2.7  
SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce...    27   3.6  
SPCC1223.07c |||aspartate-tRNA ligase |Schizosaccharomyces pombe...    26   6.3  
SPAC890.03 |ppk16|mug92|serine/threonine protein kinase Ppk16 |S...    26   6.3  
SPAC22F8.08 |||COPII vesicle coat protein |Schizosaccharomyces p...    25   8.4  
SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pomb...    25   8.4  
SPBC405.02c ||SPBC4C3.01|sequence orphan|Schizosaccharomyces pom...    25   8.4  

>SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha
           Ef1a-a |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 460

 Score =  180 bits (439), Expect = 1e-46
 Identities = 86/125 (68%), Positives = 101/125 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET KY VT+IDAPGHRDFIKNMITGTSQADCAVLI+  GTGEFEAGISK+GQTREHAL
Sbjct: 79  KFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAVLIIGGGTGEFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIV VNKMD+T   +      +  ++  +  KK+G+NP  V FVP+SG+ G
Sbjct: 139 LAYTLGVKQLIVAVNKMDTT--GWSQARFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQG 196

Query: 617 DNMLE 631
           DNM+E
Sbjct: 197 DNMIE 201



 Score =  141 bits (341), Expect = 1e-34
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha
           Ef1a-b |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 460

 Score =  180 bits (438), Expect = 2e-46
 Identities = 85/125 (68%), Positives = 101/125 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET KY VT+IDAPGHRDFIKNMITGTSQADCA+LI+  GTGEFEAGISK+GQTREHAL
Sbjct: 79  KFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGTGEFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIV VNKMD+T   +      +  ++  +  KK+G+NP  V FVP+SG+ G
Sbjct: 139 LAYTLGVKQLIVAVNKMDTT--GWSQARFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQG 196

Query: 617 DNMLE 631
           DNM+E
Sbjct: 197 DNMIE 201



 Score =  141 bits (341), Expect = 1e-34
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha
           Ef1a-c |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 460

 Score =  180 bits (438), Expect = 2e-46
 Identities = 85/125 (68%), Positives = 101/125 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET KY VT+IDAPGHRDFIKNMITGTSQADCA+LI+  GTGEFEAGISK+GQTREHAL
Sbjct: 79  KFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGTGEFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIV VNKMD+T   +      +  ++  +  KK+G+NP  V FVP+SG+ G
Sbjct: 139 LAYTLGVKQLIVAVNKMDTT--GWSQARFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQG 196

Query: 617 DNMLE 631
           DNM+E
Sbjct: 197 DNMIE 201



 Score =  141 bits (341), Expect = 1e-34
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL
Sbjct: 1   MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>SPCC584.04 |sup35|erf3|translation release factor eRF3
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score =  106 bits (254), Expect = 4e-24
 Identities = 51/124 (41%), Positives = 76/124 (61%), Gaps = 2/124 (1%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET     +++DAPGH+ ++ NMI G SQAD  VL+++A  GEFEAG  + GQTREHA+L
Sbjct: 311 FETEHRRFSLLDAPGHKGYVTNMINGASQADIGVLVISARRGEFEAGFERGGQTREHAVL 370

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKI-GYNPAA-VAFVPISGWH 613
           A T G+  L+V +NKMD     +     ++   K     +++ GYN    V ++P+S + 
Sbjct: 371 ARTQGINHLVVVINKMDEPSVQWSEERYKECVDKLSMFLRRVAGYNSKTDVKYMPVSAYT 430

Query: 614 GDNM 625
           G N+
Sbjct: 431 GQNV 434



 Score = 80.6 bits (190), Expect = 2e-16
 Identities = 35/64 (54%), Positives = 47/64 (73%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H+NIV IGHVD+GKST  G++++  G +DKRT+EK E+EA+E GK S+  +W LD   
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKESWYLSWALDSTS 295

Query: 217 AERE 228
            ERE
Sbjct: 296 EERE 299


>SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 592

 Score =  100 bits (240), Expect = 2e-22
 Identities = 56/129 (43%), Positives = 73/129 (56%), Gaps = 2/129 (1%)
 Frame = +2

Query: 251 SRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 430
           S  FE+ K    I DAPGHRDFI  MI G S AD AVL+V +    FE G  +NGQTREH
Sbjct: 247 STTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFERGFLENGQTREH 306

Query: 431 ALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTF--KKIGYNPAAVAFVPIS 604
           A L   LG+ +++V VNK+D       S D  +  +     F  K +G+  + V FVPIS
Sbjct: 307 AYLLRALGISEIVVSVNKLDLMS---WSEDRFQEIKNIVSDFLIKMVGFKTSNVHFVPIS 363

Query: 605 GWHGDNMLE 631
              G N+++
Sbjct: 364 AISGTNLIQ 372



 Score = 72.5 bits (170), Expect = 6e-14
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +++VV GHVDSGKST  G ++++ G I+ R+++K   EA   GKGSF YAW+LD  +
Sbjct: 175 KPVVHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTE 234

Query: 217 AER 225
            ER
Sbjct: 235 EER 237


>SPBC9B6.04c |tuf1||mitochondrial translation elongation factor
           EF-Tu Tuf1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 439

 Score = 77.8 bits (183), Expect = 1e-15
 Identities = 37/85 (43%), Positives = 55/85 (64%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET+  +   +D PGH D+IKNMITG +  D A+++V+A  G+         QTREH L
Sbjct: 110 EYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMP-------QTREHLL 162

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYV 511
           LA  +GVKQ++V +NK+D  EP  +
Sbjct: 163 LARQVGVKQIVVYINKVDMVEPDMI 187



 Score = 35.1 bits (77), Expect = 0.010
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKC 117
           ++K H+NI  IGHVD GK+T T   I KC
Sbjct: 49  RKKPHVNIGTIGHVDHGKTTLTA-AITKC 76


>SPBC17G9.09 |tif213||translation initiation factor eIF2 gamma
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 446

 Score = 37.1 bits (82), Expect = 0.003
 Identities = 20/71 (28%), Positives = 34/71 (47%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 109 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMQL 162

Query: 458 KQLIVGVNKMD 490
           K +I+  NK+D
Sbjct: 163 KHIIILQNKVD 173


>SPCP31B10.07 |eft202||translation elongation factor 2
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 842

 Score = 35.5 bits (78), Expect = 0.008
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           MGK     N+ VI HVD GKST T  L+ K G
Sbjct: 13  MGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAG 44



 Score = 27.9 bits (59), Expect = 1.6
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           + V +ID+PGH DF   +       D A+++V
Sbjct: 98  FLVNLIDSPGHVDFSSEVTAALRVTDGALVVV 129


>SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation
           elongation factor 2 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 842

 Score = 35.5 bits (78), Expect = 0.008
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           MGK     N+ VI HVD GKST T  L+ K G
Sbjct: 13  MGKPSNVRNMSVIAHVDHGKSTLTDSLVQKAG 44



 Score = 27.9 bits (59), Expect = 1.6
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           + V +ID+PGH DF   +       D A+++V
Sbjct: 98  FLVNLIDSPGHVDFSSEVTAALRVTDGALVVV 129


>SPBC1306.01c ||SPBC409.22c|translation elongation factor
           G|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 770

 Score = 34.3 bits (75), Expect = 0.018
 Identities = 21/57 (36%), Positives = 29/57 (50%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 430
           FE S Y + IID PGH DF   +       D AVL++ A +G     I+ + Q R +
Sbjct: 141 FEKS-YNINIIDTPGHIDFTIEVERALRVLDGAVLVLCAVSGVQSQTITVDRQMRRY 196



 Score = 29.1 bits (62), Expect = 0.68
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGI 126
           NI +  H+DSGK+T T  ++Y  G I
Sbjct: 61  NIGISAHIDSGKTTFTERVLYYTGRI 86


>SPBC1271.15c |||translation initiation factor
           IF-2Mt|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 686

 Score = 33.5 bits (73), Expect = 0.032
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           F+    ++T +D PGH  F      G + AD  VL+VA   G
Sbjct: 215 FDKGSKFITFLDTPGHMAFEAMRKRGANIADIVVLVVAGDDG 256


>SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1000

 Score = 30.3 bits (65), Expect = 0.29
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           Y + +ID+PGH DF   + + +   D A ++V A  G
Sbjct: 94  YLINLIDSPGHVDFSSEVSSASRLCDGAFVLVDAVEG 130


>SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 646

 Score = 29.9 bits (64), Expect = 0.39
 Identities = 12/42 (28%), Positives = 21/42 (50%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           +    Y + +ID PGH DF   ++   +  +  +L+V A  G
Sbjct: 119 YHGQSYLLNLIDTPGHVDFRAEVMHSLAACEGCILLVDASQG 160


>SPAC56F8.03 |||translation initiation factor IF2
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1079

 Score = 29.5 bits (63), Expect = 0.51
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIV 370
           IID PGH  F      GTS  + A+L++
Sbjct: 553 IIDTPGHESFTNLRSRGTSLCNIAILVI 580


>SPBC405.01 |ade1|min4, SPBC4C3.02c|phosphoribosylamine-glycine
           ligase |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 788

 Score = 29.1 bits (62), Expect = 0.68
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = -1

Query: 274 LASFELPRAISIVIPXHAQPLVCPIPKHI*RILYPFPGPPSRTSR 140
           L  F L + +++VIP    PLV  I  H  R+  P  GP +  +R
Sbjct: 62  LVKFALDKDVNLVIPGPELPLVEGIEGHFRRVGIPCFGPSALAAR 106


>SPBC660.10 |||translation elongation factor G|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 813

 Score = 29.1 bits (62), Expect = 0.68
 Identities = 23/70 (32%), Positives = 34/70 (48%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           + +ID PGH DF   +    +  D AV I+     +  AG+    QT+     A   G+ 
Sbjct: 95  INLIDTPGHADFTFEVERSVAVLDGAVAII-----DGSAGV--EAQTKVVWKQATKRGIP 147

Query: 461 QLIVGVNKMD 490
           ++I  VNKMD
Sbjct: 148 KVIF-VNKMD 156



 Score = 28.7 bits (61), Expect = 0.90
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           N+ +I H+D+GK+T T  ++Y  G
Sbjct: 30  NVGIIAHIDAGKTTLTEKMLYYGG 53


>SPAC17C9.03 |tif471||translation initiation factor eIF4G
            |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1403

 Score = 27.1 bits (57), Expect = 2.7
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 7/95 (7%)
 Frame = +2

Query: 464  LIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPI-------SGWHGDN 622
            + VGVN +D+TE  + + D+   R +   T  KI   P+ + F+ +       +GW   N
Sbjct: 1195 MTVGVN-IDATEKGHAAMDVYVLRME---TITKIPNLPSRIKFMLMDVMDSRKNGWAVKN 1250

Query: 623  MLELQPKCLGSRDGQVERKVRPS*RKMPH*SSRCH 727
             +E  PK +     + ERK   +  + P  S R H
Sbjct: 1251 EVEKGPKTIAEIHEEAERKKALAESQRPS-SGRMH 1284


>SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 983

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIV 370
           ID PGH DF+  +    + +D  VL+V
Sbjct: 214 IDTPGHVDFVDEVAAPMAISDGVVLVV 240


>SPCC1223.07c |||aspartate-tRNA ligase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 580

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +1

Query: 502 TIREPRFEEIKKEVSSYIQEDWLQPSCCRFRAHF 603
           TIRE   +++      Y  ED++ P   R R HF
Sbjct: 374 TIREKYAKQVAVVRQQYPSEDFILPDADRIRFHF 407


>SPAC890.03 |ppk16|mug92|serine/threonine protein kinase Ppk16
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 672

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 9/19 (47%), Positives = 15/19 (78%)
 Frame = +1

Query: 463 AHRRSKQNGFH*TTIREPR 519
           +H   K+NG+H ++IR+PR
Sbjct: 275 SHPYFKENGYHSSSIRDPR 293


>SPAC22F8.08 |||COPII vesicle coat protein |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 926

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 24/60 (40%), Positives = 31/60 (51%)
 Frame = +2

Query: 368 VAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYP 547
           VA GT E   GI  NG   E+A+ A       +I  V++    +PP VS    KSRR+YP
Sbjct: 47  VAEGTAE---GIVSNG---EYAVGAMGAAPTNIIGSVDQ----QPP-VSHTSHKSRRQYP 95


>SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 662

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = -1

Query: 211 VCPIPKHI*RILYPFPGPPSRTSRWYVCQYHHICRSSDQWWWT 83
           V  +PK I  I++ F  P S  S    C+Y     S D  W T
Sbjct: 31  VLNLPKEILIIIFSFLDPRSLLSAQCTCKYWKKLLSDDLSWRT 73


>SPBC405.02c ||SPBC4C3.01|sequence orphan|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 447

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -1

Query: 700 FPSAWPYLTLHLPIP*TKAFWLKLQHV 620
           FP  W  L   LPIP TK   ++++HV
Sbjct: 395 FPPLW-ILASFLPIPRTKIHQMRVKHV 420


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,956,575
Number of Sequences: 5004
Number of extensions: 61786
Number of successful extensions: 234
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 202
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 227
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 343230174
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -