SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30098.Seq
         (617 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1682.14 |rpl1902|rpl19-2|60S ribosomal protein L19B|Schizosa...   134   1e-32
SPBC56F2.02 |rpl1901|rpl19-1|60S ribosomal protein L19|Schizosac...   134   1e-32
SPBC9B6.07 |||nucleolar protein Nop52 family |Schizosaccharomyce...    29   0.41 
SPBC12C2.02c |ste20|ste16|sterility protein Ste20|Schizosaccharo...    29   0.54 
SPBC28E12.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|...    29   0.71 
SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1...    27   1.6  
SPAC23C11.03 |||U3 snoRNP-associated protein Mpp1 |Schizosacchar...    27   2.9  
SPBC21.05c |ral2||Ras guanyl-nucleotide exchange factor Ral2 |Sc...    26   5.0  
SPAC3H8.02 |||sec14 cytosolic factor family|Schizosaccharomyces ...    25   8.8  
SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces ...    25   8.8  
SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||...    25   8.8  

>SPCC1682.14 |rpl1902|rpl19-2|60S ribosomal protein
           L19B|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 193

 Score =  134 bits (324), Expect = 1e-32
 Identities = 58/85 (68%), Positives = 75/85 (88%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M++L+ QKRLAASV++CGK+KVW+DPNEI+EI+N NSRQNIRK++KDGLVI+KP  +HSR
Sbjct: 1   MANLRTQKRLAASVLKCGKRKVWMDPNEISEISNANSRQNIRKLVKDGLVIRKPNLMHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
            R+RK   A+R GRH G+GKR+GTA
Sbjct: 61  FRIRKTHAAKRLGRHTGYGKRKGTA 85



 Score = 86.2 bits (204), Expect = 3e-18
 Identities = 41/100 (41%), Positives = 57/100 (57%)
 Frame = +3

Query: 243 KRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 422
           K    ARMP   +W                + KID+HLYH+LY++AKGN FK+KR L+E+
Sbjct: 82  KGTAEARMPSTVVWMRRQRVLRRLLRKYRESGKIDKHLYHTLYLEAKGNTFKHKRALIEH 141

Query: 423 IHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           I R KAE  RTK++ +Q +ARR + K AR      +  +R
Sbjct: 142 IQRAKAEANRTKLIQEQQDARRARAKAARQRRAKAVEEKR 181


>SPBC56F2.02 |rpl1901|rpl19-1|60S ribosomal protein
           L19|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 193

 Score =  134 bits (324), Expect = 1e-32
 Identities = 58/85 (68%), Positives = 75/85 (88%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M++L+ QKRLAASV++CGK+KVW+DPNEI+EI+N NSRQN+RK+IKDGLVI+KP  +HSR
Sbjct: 1   MANLRTQKRLAASVLKCGKRKVWMDPNEISEISNANSRQNVRKLIKDGLVIRKPNLMHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
            R+RK   A+R GRH G+GKR+GTA
Sbjct: 61  FRIRKTHAAKRLGRHTGYGKRKGTA 85



 Score = 86.2 bits (204), Expect = 3e-18
 Identities = 41/100 (41%), Positives = 57/100 (57%)
 Frame = +3

Query: 243 KRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 422
           K    ARMP   +W                + KID+HLYH+LY++AKGN FK+KR L+E+
Sbjct: 82  KGTAEARMPSAVVWMRRQRVLRRLLRKYRESGKIDKHLYHTLYLEAKGNTFKHKRALIEH 141

Query: 423 IHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           I R KAE  RTK++ +Q +ARR + K AR      +  +R
Sbjct: 142 IQRAKAEANRTKLIQEQQDARRARAKAARQRRAKAVEEKR 181


>SPBC9B6.07 |||nucleolar protein Nop52 family |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 217

 Score = 29.5 bits (63), Expect = 0.41
 Identities = 12/30 (40%), Positives = 15/30 (50%)
 Frame = -1

Query: 203 SVFLRTRAREWTATGFLMTRPSLIILRMFC 114
           S F  T  REWT    L T    +++R FC
Sbjct: 85  STFWETMGREWTGIDILRTDKFYLLMRRFC 114


>SPBC12C2.02c |ste20|ste16|sterility protein
           Ste20|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1309

 Score = 29.1 bits (62), Expect = 0.54
 Identities = 12/30 (40%), Positives = 21/30 (70%)
 Frame = -3

Query: 144 TILDHLTDVLSGVGVCDLIDFIWIQPHLLF 55
           +I +H++DV  G+ V  LI+ + I+P +LF
Sbjct: 351 SICEHVSDVSRGIAVETLIELMIIRPKILF 380


>SPBC28E12.04 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 356

 Score = 28.7 bits (61), Expect = 0.71
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = -3

Query: 123 DVLSGVGVCDLIDFIWIQPHLLFTTSHNRGCK 28
           +VLS +    ++D  +  PHLL  +S N+ CK
Sbjct: 237 EVLSKLPYFHILDKSFFSPHLLLQSSENQACK 268


>SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1841

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 21/73 (28%), Positives = 32/73 (43%)
 Frame = +3

Query: 384  GNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRNCCRPS 563
            G + K + V +E  H+ +   A T       EA     K   S A+N L   +R+  +  
Sbjct: 1414 GFLDKLRNVKLESHHKPRNRSAITMGKEHLIEAPNTSTKS--SPAKNELFVPKRSSVKSD 1471

Query: 564  LEKTKPRLPLRSK 602
            L K +PR P  S+
Sbjct: 1472 LAKVRPRYPKGSE 1484


>SPAC23C11.03 |||U3 snoRNP-associated protein Mpp1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 598

 Score = 26.6 bits (56), Expect = 2.9
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = +3

Query: 417 EYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRN 548
           E I R     + T+M   Q +ARR +V+   +  R  +  +RRN
Sbjct: 510 ETITRSGIAISSTEMDHQQKQARRRRVRRKHAEKRKQMAEKRRN 553


>SPBC21.05c |ral2||Ras guanyl-nucleotide exchange factor Ral2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 611

 Score = 25.8 bits (54), Expect = 5.0
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = -2

Query: 439 AFFLWMYSMSTRLFLNTLPFAFM-*SEWYRCL 347
           AF LW+YS+   L+L       +    W++CL
Sbjct: 337 AFVLWVYSLDKELWLQLDMLGVLNHGSWFKCL 368


>SPAC3H8.02 |||sec14 cytosolic factor family|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 444

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 11/65 (16%)
 Frame = +1

Query: 61  KVWLDPNEINEIANTNSRQNIRKMIKDGLVIKK-----------PVAVHSRARVRKNTEA 207
           K WLDP  ++++  T + +++++ I    ++K+           P    + A   KN EA
Sbjct: 289 KSWLDPVVVSKVKFTRNYRDLQQYINPDNILKEFGGPNPWRYTYPEPCQNEAEALKNVEA 348

Query: 208 RRKGR 222
           R+  R
Sbjct: 349 RKSLR 353


>SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 620

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = +1

Query: 115 QNIRKMIKDGLVIKKPVAVHSRARVRKNTEARRKGRHCG 231
           +++R  +KD +   +PV+V S A   ++T     G   G
Sbjct: 141 ESLRSKLKDAMASTEPVSVDSAAAPSQSTNPEGNGGSVG 179


>SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 600

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%)
 Frame = +1

Query: 4   SSLKLQKRLAASVMRCGKK--KVWLDPNEINEIANTNSRQNIRK 129
           S + + K L  S MRCG+K    W++ + +    NT+   +  K
Sbjct: 317 SYISVIKALEHSAMRCGRKLDLQWVEASHLEASTNTSDPLSYHK 360


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,479,682
Number of Sequences: 5004
Number of extensions: 51357
Number of successful extensions: 174
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 169
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 174
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 271646730
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -