SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30090.Seq
         (437 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC776.01 |rpl29||60S ribosomal protein L29|Schizosaccharomyces...    56   2e-09
SPAC10F6.10 |||protein kinase, RIO family |Schizosaccharomyces p...    25   3.9  
SPBC342.06c |rtt109|kat11|RTT109 family histone lysine acetyltra...    25   5.1  

>SPBC776.01 |rpl29||60S ribosomal protein L29|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 61

 Score = 56.0 bits (129), Expect = 2e-09
 Identities = 22/30 (73%), Positives = 27/30 (90%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHTNHNQN+KAHRNGIK+P+K R++
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPQKHRYD 30


>SPAC10F6.10 |||protein kinase, RIO family |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 521

 Score = 25.4 bits (53), Expect = 3.9
 Identities = 15/51 (29%), Positives = 25/51 (49%)
 Frame = +2

Query: 167 GKXXESYKS*PEPQSSQKWYQKAKEDQARTTLGMDPKFLRNQRFCKKGNLK 319
           GK     K  PE + ++K  +K KED+A       PK+ + ++  + G  K
Sbjct: 473 GKGNGRAKETPEEKRARK--KKTKEDKAEKRKSKIPKYEKKRKLKQSGRKK 521


>SPBC342.06c |rtt109|kat11|RTT109 family histone lysine
           acetyltransferase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 369

 Score = 25.0 bits (52), Expect = 5.1
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRK 242
           +AK  +  NHN ++ A +  I +PRK
Sbjct: 340 LAKRDDRKNHNHSKPATQANILQPRK 365


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,443,394
Number of Sequences: 5004
Number of extensions: 23829
Number of successful extensions: 46
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 158122380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -