SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30074.Seq
         (450 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch...    26   3.1  
SPCC1235.04c |||FAD synthetase|Schizosaccharomyces pombe|chr 3||...    24   9.4  
SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosacchar...    24   9.4  

>SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit
           Rev3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1480

 Score = 25.8 bits (54), Expect = 3.1
 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%)
 Frame = +2

Query: 290 VCSLLHFCY-YIFISTSSLAVCLDLNNSHYRRPLFISTYYA 409
           VC  +H  + YI++  SS A  LDL    +   L  S  YA
Sbjct: 51  VCCFIHNVFPYIYVEYSSFAETLDLEVPDFLSQLQTSINYA 91


>SPCC1235.04c |||FAD synthetase|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 265

 Score = 24.2 bits (50), Expect = 9.4
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = -3

Query: 196 ILYWEGIFIYQEDLVFNLKYCSLF*S**FKLGNLTTVFDNDSLR 65
           IL W    I+   L  N KYCSL+      LG ++    N +L+
Sbjct: 172 ILDWSYTEIWDLLLETNTKYCSLYDRGYTSLGGVSDTSPNPALK 215


>SPCC1672.07 |||U3 snoRNP-associated protein Utp21
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 902

 Score = 24.2 bits (50), Expect = 9.4
 Identities = 11/36 (30%), Positives = 16/36 (44%)
 Frame = +2

Query: 317 YIFISTSSLAVCLDLNNSHYRRPLFISTYYASIWYI 424
           +IF S       L   N HY  P F+  Y  S+ ++
Sbjct: 316 WIFDSMDGAPRILRSRNGHYEPPSFVKFYGKSVHFL 351


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,643,958
Number of Sequences: 5004
Number of extensions: 28388
Number of successful extensions: 43
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 40
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 166231220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -