SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30059.Seq
         (702 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC2G5.01 |||DUF1682 family protein|Schizosaccharomyces pombe|c...    27   3.4  
SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha...    25   7.9  
SPAC1783.04c |hst4||Sir2 family histone deacetylase Hst4|Schizos...    25   7.9  
SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|...    25   7.9  

>SPBC2G5.01 |||DUF1682 family protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 374

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = -3

Query: 139 TGLRRCIKNLAAYILIKFPSIPXSKNKLYL 50
           + +  CI+NL  +I+   PS+P +  K Y+
Sbjct: 236 SSINECIENLEYFIVTDQPSVPPATEKDYV 265


>SPAC4F8.11 |||WD repeat protein, human WDR24
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 846

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 4/66 (6%)
 Frame = +3

Query: 57  NLFFXCGMLGNL----INMYAAKFLIHRRSPVFLLNRVSITTKKKVHDPSEEELLPIFQY 224
           NL F C  LGNL    +N+ A  +  +  S       +S      V   S++ L+ ++ Y
Sbjct: 105 NLIFTCSPLGNLNVWDVNLEALLYDFNEHSRAVHKLDISSFHPSYVLTASQDGLIKLWDY 164

Query: 225 PISKST 242
             S ST
Sbjct: 165 KESSST 170


>SPAC1783.04c |hst4||Sir2 family histone deacetylase
           Hst4|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 415

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 19/56 (33%), Positives = 24/56 (42%)
 Frame = -3

Query: 616 LCEHVPLPTALISHSKLLVRYINRCIAKQKFQRXISRGEMVSNLGICIDTGTENFV 449
           L +  P PT +  H  L V    RC   +KF   I     V+   +C D  TEN V
Sbjct: 171 LPQSAPWPTTIPLHGTLEVVSCTRCSFLKKFNPDIFDRNGVT---VCPDCKTENEV 223


>SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit
           Alp4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 784

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -3

Query: 616 LCEHVPLPTALISHSKLLVRY 554
           LC  VP P +LI   K ++RY
Sbjct: 568 LCYKVPFPLSLILSRKAIIRY 588


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,820,664
Number of Sequences: 5004
Number of extensions: 56507
Number of successful extensions: 145
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 140
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 145
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 325165428
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -