SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30044.Seq
         (443 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC776.01 |rpl29||60S ribosomal protein L29|Schizosaccharomyces...    60   1e-10
SPCC970.02 |||mannan endo-1,6-alpha-mannosidase|Schizosaccharomy...    25   4.0  
SPBC342.06c |rtt109|kat11|RTT109 family histone lysine acetyltra...    25   5.2  
SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces pombe...    25   6.9  
SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces p...    25   6.9  
SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei...    24   9.1  

>SPBC776.01 |rpl29||60S ribosomal protein L29|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 61

 Score = 60.5 bits (140), Expect = 1e-10
 Identities = 24/30 (80%), Positives = 29/30 (96%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAKSKNHTNHNQN+KAHRNGIK+P+K R++
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPQKHRYD 30


>SPCC970.02 |||mannan endo-1,6-alpha-mannosidase|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 442

 Score = 25.4 bits (53), Expect = 4.0
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +1

Query: 109 VGIYSNDFIFLYRIENSSKWQSQRIIQIITKTAK 210
           +G+Y     ++Y   NS+ W++ R+     KTAK
Sbjct: 249 IGLYMAGAAYMYNYTNSTVWKT-RVEGFANKTAK 281


>SPBC342.06c |rtt109|kat11|RTT109 family histone lysine
           acetyltransferase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 369

 Score = 25.0 bits (52), Expect = 5.2
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRK 242
           +AK  +  NHN ++ A +  I +PRK
Sbjct: 340 LAKRDDRKNHNHSKPATQANILQPRK 365


>SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 727

 Score = 24.6 bits (51), Expect = 6.9
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +1

Query: 196 TKTAKLTEMVSKSQGRPGTN 255
           T  A +T++VSK  G PG N
Sbjct: 220 TNPADITDLVSKYAGPPGNN 239


>SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 245

 Score = 24.6 bits (51), Expect = 6.9
 Identities = 9/30 (30%), Positives = 19/30 (63%), Gaps = 1/30 (3%)
 Frame = +3

Query: 174 SKNHTNHNQNRK-AHRNGIKKPRKTRHEPP 260
           S N+ NHNQ++   +R+  +  ++ ++ PP
Sbjct: 182 SSNNKNHNQSKNPQNRSNSRSKQRNKNAPP 211


>SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1462

 Score = 24.2 bits (50), Expect = 9.1
 Identities = 17/61 (27%), Positives = 25/61 (40%)
 Frame = +3

Query: 195 NQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGRLREKLPEKQR 374
           N NR+A       P++     P+  + N        +  T S  SNS G  R  LP++  
Sbjct: 502 NPNRQAASFNFSGPKRA----PIRPLSNLRSFSKSQKEETSSNSSNSSGTRRLGLPQRAT 557

Query: 375 P 377
           P
Sbjct: 558 P 558


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,515,233
Number of Sequences: 5004
Number of extensions: 26090
Number of successful extensions: 58
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 56
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 162176800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -