SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30018.Seq
         (825 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1A4.07c |||U3 snoRNP-associated protein Sof1|Schizosaccharom...    31   0.26 
SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces ...    28   1.4  
SPCC1393.06c |||rRNA processing protein Ipi1|Schizosaccharomyces...    27   2.4  
SPAC17H9.19c |cdt2|sev1|WD repeat protein Cdt2|Schizosaccharomyc...    27   3.2  
SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr...    27   4.3  
SPCC18.05c |||notchless-like protein|Schizosaccharomyces pombe|c...    27   4.3  
SPBC3H7.09 |mug142||palmitoyltransferase|Schizosaccharomyces pom...    26   5.6  
SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe...    25   9.9  

>SPBC1A4.07c |||U3 snoRNP-associated protein
           Sof1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 436

 Score = 30.7 bits (66), Expect = 0.26
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = +1

Query: 277 WVPAKHFSAKVTALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQTY 411
           W    H    V  L +S +  + SC  D  VY  N +DG VK++Y
Sbjct: 101 WTSKAH-EGIVRGLVFSNQGDVLSCASDRYVYMLNKQDGKVKRSY 144


>SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1502

 Score = 28.3 bits (60), Expect = 1.4
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -1

Query: 516 DASTKYRDXWCWIVWYNFYG 457
           +  TK+ + WC I+ Y FYG
Sbjct: 234 EVETKWMNIWCPIILYEFYG 253


>SPCC1393.06c |||rRNA processing protein Ipi1|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 408

 Score = 27.5 bits (58), Expect = 2.4
 Identities = 17/75 (22%), Positives = 35/75 (46%), Gaps = 2/75 (2%)
 Frame = +1

Query: 235 TVNILNNQAKIINVWVPA--KHFSAKVTALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQT 408
           T +I N+  K +++ + A     S+   +L W +    ++      +  WN E  SVK+T
Sbjct: 153 TPSIRNDSTKFLSLLINACKDRLSSSAISLQWKKTLECFT-----NLLGWNSESASVKRT 207

Query: 409 YNISIENNTKQGSHI 453
            + S +++     H+
Sbjct: 208 TSFSKKSSANMIRHL 222


>SPAC17H9.19c |cdt2|sev1|WD repeat protein Cdt2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 490

 Score = 27.1 bits (57), Expect = 3.2
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +1

Query: 307 VTALDWSRKYGLYSCTKDSRVYEWN 381
           VTA+DWS +  L S + D  V  WN
Sbjct: 440 VTAVDWSSEGQLASISDDGSVRVWN 464


>SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 905

 Score = 26.6 bits (56), Expect = 4.3
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +1

Query: 694 DVXGXPDGKALKNKPTIXADXPNKRSPRXKAXVRVPGPNPTP 819
           D    PDGKA K +P    + P+       +   +P PNP P
Sbjct: 516 DTLQTPDGKAFKFRPPQGVELPSAGFIAGDSSY-IPEPNPQP 556


>SPCC18.05c |||notchless-like protein|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 502

 Score = 26.6 bits (56), Expect = 4.3
 Identities = 14/53 (26%), Positives = 29/53 (54%)
 Frame = +1

Query: 235 TVNILNNQAKIINVWVPAKHFSAKVTALDWSRKYGLYSCTKDSRVYEWNIEDG 393
           TV I N + + + ++  + H +A +T + W  +  +YS + D  +  W+ +DG
Sbjct: 250 TVRIWNVKLRTL-LFTLSGH-TAPITCVRWGGQNWIYSSSYDKTIRIWDAKDG 300


>SPBC3H7.09 |mug142||palmitoyltransferase|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 350

 Score = 26.2 bits (55), Expect = 5.6
 Identities = 15/65 (23%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = +1

Query: 289 KHFSAKVTALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQTYNISIENNTKQGSHINA-IK 465
           KH  AK +   W++ +  +  T     Y  N+E+ +       S+ ++  +  HI +  K
Sbjct: 5   KHSDAKASRYAWNQPWNPFEVTLSDPTYPMNLEEKNQIPYRFQSVPDDVPEVPHIESRYK 64

Query: 466 IIPHN 480
            +P N
Sbjct: 65  NLPGN 69


>SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 488

 Score = 25.4 bits (53), Expect = 9.9
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = +1

Query: 316 LDWSRKYGLYSCTKDSRVYEWNIEDGSV 399
           LDWS    + +   +  VY WN + GSV
Sbjct: 186 LDWSN-LNVVAVALERNVYVWNADSGSV 212


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,988,043
Number of Sequences: 5004
Number of extensions: 59171
Number of successful extensions: 145
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 142
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 145
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 404442380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -