SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30011.Seq
         (628 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAP7G5.05 |rpl1002|rpl10-2, rpl10|60S ribosomal protein L10|Sch...   142   5e-35
SPBC18E5.04 |rpl1001|rpl10-1, rpl10|60S ribosomal protein L10|Sc...   142   5e-35
SPCC594.06c |||SNARE Vam7 |Schizosaccharomyces pombe|chr 3|||Manual    27   2.9  

>SPAP7G5.05 |rpl1002|rpl10-2, rpl10|60S ribosomal protein
           L10|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 221

 Score =  142 bits (343), Expect = 5e-35
 Identities = 63/85 (74%), Positives = 70/85 (82%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  R VPD KIRIFDLG+  A VD+FPLC+HLVS+EYEQ++SE
Sbjct: 4   RPARCYRYCKNKPYPKSRYNRAVPDSKIRIFDLGRKRAGVDEFPLCIHLVSNEYEQITSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N YLVK  G D FH+R
Sbjct: 64  ALEAARICANKYLVKIGGKDSFHLR 88



 Score =  106 bits (254), Expect = 3e-24
 Identities = 53/94 (56%), Positives = 65/94 (69%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R HPFHV+RINKMLSCAGAD LQTGMR AFGKP G VARV IGQ +MSVR       T 
Sbjct: 89  VRAHPFHVVRINKMLSCAGADRLQTGMRHAFGKPNGLVARVNIGQVLMSVRTKDSSRATA 148

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
              +     +KFPG+ + +  K+ GF++Y RDE+
Sbjct: 149 IE-ALRRCQYKFPGQQRIIVSKKWGFSQYARDEY 181


>SPBC18E5.04 |rpl1001|rpl10-1, rpl10|60S ribosomal protein
           L10|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 221

 Score =  142 bits (343), Expect = 5e-35
 Identities = 63/85 (74%), Positives = 70/85 (82%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  R VPD KIRIFDLG+  A VD+FPLC+HLVS+EYEQ++SE
Sbjct: 4   RPARCYRYCKNKPYPKSRYNRAVPDSKIRIFDLGRKRAGVDEFPLCIHLVSNEYEQITSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N YLVK  G D FH+R
Sbjct: 64  ALEAARICANKYLVKIGGKDSFHLR 88



 Score =  106 bits (254), Expect = 3e-24
 Identities = 53/94 (56%), Positives = 65/94 (69%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R HPFHV+RINKMLSCAGAD LQTGMR AFGKP G VARV IGQ +MSVR       T 
Sbjct: 89  VRAHPFHVVRINKMLSCAGADRLQTGMRHAFGKPNGLVARVNIGQILMSVRTKDSSRATA 148

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
              +     +KFPG+ + +  K+ GF++Y RDE+
Sbjct: 149 IE-ALRRCQYKFPGQQRIIVSKKWGFSQYARDEY 181


>SPCC594.06c |||SNARE Vam7 |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 341

 Score = 26.6 bits (56), Expect = 2.9
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 377 SHWTXHHVRAALVTGGRH 430
           S WT +H+  A   GG+H
Sbjct: 18  SRWTVYHIEVAFPNGGKH 35


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,286,114
Number of Sequences: 5004
Number of extensions: 40871
Number of successful extensions: 126
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 107
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 124
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 277683324
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -