BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30093 (501 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC63.03 |||DNAJ domain protein, DNAJC11 family|Schizosaccharom... 27 1.6 SPCC553.12c ||SPCC794.13|conserved fungal protein|Schizosaccharo... 26 2.8 SPAC3A11.11c |||pyridoxal reductase |Schizosaccharomyces pombe|c... 26 3.7 SPBC1711.13 |his2||histidinol dehydrogenase His2 |Schizosaccharo... 25 4.8 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 25 8.4 >SPCC63.03 |||DNAJ domain protein, DNAJC11 family|Schizosaccharomyces pombe|chr 3|||Manual Length = 642 Score = 27.1 bits (57), Expect = 1.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 67 PVSVAIDASHTSFQLYSSGVYNEEECSSTDLDHG 168 P S + D SF +SSG +++E + +D D G Sbjct: 173 PTSFSNDLKKPSFNSFSSGSFDDEFSAPSDEDEG 206 >SPCC553.12c ||SPCC794.13|conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 521 Score = 26.2 bits (55), Expect = 2.8 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 339 SLPRSCNIHISYVYLWLS--YLCNMYNS 416 +LP S + I YVY W LCN+ +S Sbjct: 290 TLPHSSTVAIMYVYSWTGTVSLCNLVSS 317 >SPAC3A11.11c |||pyridoxal reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 334 Score = 25.8 bits (54), Expect = 3.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 234 PRVLHEPVVHALLVGAVT 181 P V H P+ H LL G VT Sbjct: 198 PLVAHSPLAHGLLTGRVT 215 >SPBC1711.13 |his2||histidinol dehydrogenase His2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 439 Score = 25.4 bits (53), Expect = 4.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 10 VDIPEGDEQKLMEAVATVGPVSVAID 87 +D+P G + L+ A T P SVA+D Sbjct: 237 IDLPAGPSEVLVIADETCNPESVALD 262 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 24.6 bits (51), Expect = 8.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 294 GIASSXSYPLV*TPPSLPRS 353 G AS S P V TPPSLP S Sbjct: 407 GNASRTSTPPVPTPPSLPPS 426 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,530,193 Number of Sequences: 5004 Number of extensions: 22302 Number of successful extensions: 67 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -