SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom...    31   0.19 
SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pomb...    30   0.26 
SPCC830.03 |||AAA family ATPase Grc3 |Schizosaccharomyces pombe|...    30   0.34 
SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|c...    29   0.78 
SPAC4A8.09c |cwf21||complexed with Cdc5 protein Cwf21 |Schizosac...    29   0.78 
SPAC637.11 |suv3||ATP-dependent RNA helicase Suv3|Schizosaccharo...    27   2.4  
SPAC3F10.08c |||rRNA processing protein Faf1|Schizosaccharomyces...    27   2.4  
SPAC8C9.15c |tif225||translation initiation factor eIF2B epsilon...    27   3.1  
SPBC3B9.02c |cwf28||splicing factor Cwf28|Schizosaccharomyces po...    27   3.1  
SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-...    25   7.3  
SPBC2A9.07c |||zf-PARP-type zinc finger protein|Schizosaccharomy...    25   7.3  
SPCC188.03 |cnd3||condensin subunit Cnd3 |Schizosaccharomyces po...    25   7.3  
SPAC694.04c |||conserved eukaryotic protein|Schizosaccharomyces ...    25   7.3  
SPBC27B12.12c |||CorA family magnesium ion transporter |Schizosa...    25   7.3  
SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccha...    25   7.3  
SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M...    25   9.6  
SPBC3D6.09 |dpb4||DNA polymerase epsilon subunit Dpb4 |Schizosac...    25   9.6  

>SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1016

 Score = 30.7 bits (66), Expect = 0.19
 Identities = 17/68 (25%), Positives = 29/68 (42%)
 Frame = +1

Query: 397 RKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENK 576
           +  S    H EN K    IT +       +D       P   + ++  PV + + +V + 
Sbjct: 562 KSKSSSSKHKENDKASVSITTTTTPSITPADPVPTSPKPLAIEPVKRKPVHAGNLEVTSV 621

Query: 577 ADNKIGTT 600
           +DNK+G T
Sbjct: 622 SDNKLGAT 629


>SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1018

 Score = 30.3 bits (65), Expect = 0.26
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = +3

Query: 261 IQIITMSKRNSTGAANTLFNYFTKTPPTNKKLKADATEDTDCNGSPKKQ 407
           I +I+   R ST  ++  FN     P +N  LK+DA E+TD +  P K+
Sbjct: 511 IPLISTFTRLSTRKSSNDFNSSNSRPSSNA-LKSDANENTDSSLPPSKK 558


>SPCC830.03 |||AAA family ATPase Grc3 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 736

 Score = 29.9 bits (64), Expect = 0.34
 Identities = 19/70 (27%), Positives = 33/70 (47%)
 Frame = +1

Query: 358 KRTLLKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRL 537
           K TL++   V+VP    +  +H E+ K + +ITP     K +  E    S+ + +     
Sbjct: 64  KHTLVQ---VVVPGVDHRTKLHSESSKNDSEITPDINRSKVNPQEYSEFSVASPQTISPS 120

Query: 538 NPVDSDDSDV 567
            P++ DD  V
Sbjct: 121 LPLNLDDETV 130


>SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1717

 Score = 28.7 bits (61), Expect = 0.78
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 1/64 (1%)
 Frame = +3

Query: 258 HIQIITMSKRNSTGAANTLFNYFTKTPPTNKKLKADATEDTDCNGSPK-KQ*KRNTS*KQ 434
           HIQ    S   + G        FT+ P + K+ K    E+T    SPK K  K   + K+
Sbjct: 477 HIQKYASSLTGAKGGQLKRQTIFTQGPNSTKESKQAVKEETSVKNSPKGKNTKNGKAEKE 536

Query: 435 KTRK 446
           K  K
Sbjct: 537 KPGK 540


>SPAC4A8.09c |cwf21||complexed with Cdc5 protein Cwf21
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 293

 Score = 28.7 bits (61), Expect = 0.78
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +2

Query: 242 KRRYDSYSNYNNVETKQHRGSQYS 313
           +R YDSYS+Y+ +E ++     YS
Sbjct: 216 RRHYDSYSSYDELERRRSSNESYS 239


>SPAC637.11 |suv3||ATP-dependent RNA helicase
           Suv3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 647

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 13/44 (29%), Positives = 20/44 (45%)
 Frame = +2

Query: 389 WFPEKAVKKEYILKTKNAKGKLHPHRSLRRLRVMKKKLFHCQLR 520
           W+P     + +I+           HR+L RL+  KK +F   LR
Sbjct: 163 WYPGARKLRRHIIMHVGPTNSGKTHRALERLKTCKKGIFAGPLR 206


>SPAC3F10.08c |||rRNA processing protein Faf1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 259

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 4/33 (12%)
 Frame = +1

Query: 487 DEEEVISLPTK----RKRIRLNPVDSDDSDVEN 573
           DEEE+++   +    RKR R N   SDD +VEN
Sbjct: 102 DEEEILAKKREEQKLRKRSRQNDDGSDDDEVEN 134


>SPAC8C9.15c |tif225||translation initiation factor eIF2B epsilon
           subunit|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 678

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = +1

Query: 442 ERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSD 564
           E  ++ S   + +SS EE++  +P   +R   N ++S+D D
Sbjct: 470 ELHLSDSESSETSSSSEEDMEFIPFSARRDSANTINSEDFD 510


>SPBC3B9.02c |cwf28||splicing factor Cwf28|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 381

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 4/52 (7%)
 Frame = +2

Query: 236 YNKRRYD----SYSNYNNVETKQHRGSQYSFQLFY*NTANE*KIKSGRY*RY 379
           YNKR  D     Y  Y++   KQHR  +YS   +Y   +   K +S R  RY
Sbjct: 315 YNKRDRDPDRTKYREYHSERRKQHRTDRYSDD-YYQGRSYSYKKRSHRSDRY 365


>SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl
           cis-trans isomerase Cyp7|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 463

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +1

Query: 379 PIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVI-SLPTKRKRIRLNPVDSD 555
           P+V+ P+K +     LE  K+ +++    + K   +DEE  + +L + + +IR N  D D
Sbjct: 320 PVVVRPKKRNILTEELEKYKKSKKVVLG-KRKNLENDEESTLRALSSFQSKIR-NAEDED 377

Query: 556 DSD 564
             D
Sbjct: 378 VMD 380


>SPBC2A9.07c |||zf-PARP-type zinc finger protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 274

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = +1

Query: 397 RKS-SKKGIHLENKKRERQITPSPELKKASSDEE 495
           RKS  K  +  +  K ER+ +PSP+++    DEE
Sbjct: 161 RKSVEKSSVPNKKHKAERKRSPSPKIEILEDDEE 194


>SPCC188.03 |cnd3||condensin subunit Cnd3 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 875

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 4/61 (6%)
 Frame = +1

Query: 421 HLENKKRERQITPSPELKKASSDEEEV-ISLPTKRKRI---RLNPVDSDDSDVENKADNK 588
           H +N+  E+  + +PEL K   + EE+ +S  +    +    LN  + DD D   +A N+
Sbjct: 435 HSQNQTEEQGNSNAPELNKNDYEGEEITVSQKSPSPSLPPNELNEPEPDDMDGYKEAFNE 494

Query: 589 I 591
           +
Sbjct: 495 L 495


>SPAC694.04c |||conserved eukaryotic protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 324

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +2

Query: 377 YRL*WFPEKAVKKEYILKTKNA 442
           Y L W P K + +E ILK K++
Sbjct: 194 YALSWLPAKTLAREAILKAKDS 215


>SPBC27B12.12c |||CorA family magnesium ion transporter
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 803

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +1

Query: 388 MVPRKSSKKGIHLENKKRERQITPSPELKKASSD 489
           MVP+K  KK     N+K  R+  P+ +   A  D
Sbjct: 101 MVPQKPKKKKRSRRNRKASRKKIPATQSSSADMD 134


>SPAPJ696.02 |||actin cortical patch component Lsb4
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 10/31 (32%), Positives = 19/31 (61%)
 Frame = +1

Query: 406 SKKGIHLENKKRERQITPSPELKKASSDEEE 498
           S +   ++N++ +   TPSP   ++ SDE+E
Sbjct: 300 SLRSSKMDNRRSKYADTPSPRRSRSYSDEDE 330


>SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 500

 Score = 25.0 bits (52), Expect = 9.6
 Identities = 15/65 (23%), Positives = 34/65 (52%)
 Frame = +1

Query: 391 VPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVE 570
           + ++SSK  +  +  K+E +   SPE  K S  +++     +K+K    +  +S+ S  E
Sbjct: 40  IAKQSSKTDVSPKKSKKEAKRASSPEPSKKSVKKQK----KSKKKEESSSESESESSSSE 95

Query: 571 NKADN 585
           +++ +
Sbjct: 96  SESSS 100


>SPBC3D6.09 |dpb4||DNA polymerase epsilon subunit Dpb4
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 210

 Score = 25.0 bits (52), Expect = 9.6
 Identities = 16/43 (37%), Positives = 20/43 (46%)
 Frame = +1

Query: 463 PELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNKI 591
           PE  K      E   L  K KR++L  V    SDV+N+   KI
Sbjct: 86  PEFSKTLKKHLEAYELALKEKRLKLPNV----SDVDNRKKAKI 124


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,260,723
Number of Sequences: 5004
Number of extensions: 43421
Number of successful extensions: 158
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 157
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 157
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 297805304
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -