SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B17
         (629 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1734.14c |suc1||cyclin-dependent protein kinase regulatory s...    85   1e-17
SPAC1F3.08c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual        27   2.2  
SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha...    27   3.0  
SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr 1|||M...    26   3.9  
SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1||...    26   5.2  
SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Sch...    25   6.8  
SPAC1142.08 |fhl1|SPAC8C9.01|fork head transcription factor Fhl1...    25   9.0  

>SPBC1734.14c |suc1||cyclin-dependent protein kinase regulatory
           subunit Suc1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 113

 Score = 84.6 bits (200), Expect = 1e-17
 Identities = 39/80 (48%), Positives = 50/80 (62%), Gaps = 9/80 (11%)
 Frame = +2

Query: 116 VDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTET---------EWRNLGVQQSPG 268
           +DQI YS RY DD YEYRHV+LP  + + +P  +   ET         EWR LG+ QS G
Sbjct: 22  IDQIHYSPRYADDEYEYRHVMLPKAMLKAIPTDYFNPETGTLRILQEEEWRGLGITQSLG 81

Query: 269 WLHFMVHNPEPHVLLFRRPR 328
           W  + VH PEPH+LLF+R +
Sbjct: 82  WEMYEVHVPEPHILLFKREK 101


>SPAC1F3.08c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 108

 Score = 27.1 bits (57), Expect = 2.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = +2

Query: 482 KNCSIYYKLADINYYYITLFCLS 550
           KN  + Y+L  I YYY  L CLS
Sbjct: 56  KNILLKYELFIIYYYYYLLICLS 78


>SPAC4F8.11 |||WD repeat protein, human WDR24
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 846

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 12/46 (26%), Positives = 22/46 (47%)
 Frame = +1

Query: 178 LTTGYSPHGAKIPSYDRDRVAKPWCSAESRLAPLYGAQS*TPCSII 315
           L   YSP+G  + S  RD+  + W S  ++   L    + +P + +
Sbjct: 225 LCVNYSPNGVFLASCGRDKTIRIWDSTSNKKKSLITINNVSPLNCV 270


>SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1115

 Score = 26.2 bits (55), Expect = 3.9
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 234 SGETLVFSRVPAGSTLWCTILNPMFYYLEDLELIYRLP 347
           +G+ +VF+ V     LW  + NP F    DL+L  +LP
Sbjct: 310 TGDAMVFTDVEDNIHLWSPLENPSF---SDLKLPIQLP 344


>SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1158

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 3/40 (7%)
 Frame = +2

Query: 77  LILFDAIKTTVMPVDQIQYSERYTD---DVYEYRHVILPP 187
           L+L  A+ +  M  D + YS R  D   +VY+YR +I PP
Sbjct: 254 LLLGRALDSQKMFHD-VTYSHRLRDSLKEVYQYRRIISPP 292


>SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter
           family|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 791

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = +2

Query: 572 LIQLFMTLDNTKACLWII 625
           L ++F   DNTKAC W I
Sbjct: 251 LFKIFHDNDNTKACNWTI 268


>SPAC1142.08 |fhl1|SPAC8C9.01|fork head transcription factor Fhl1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 743

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%)
 Frame = +2

Query: 266 GWLHFMVHNPEPHVLLFR-RPRTDIPAPLNGLDTNTSSAVKV 388
           G  H +  N E  +L    +  +D+P  L+  DTN S+A  +
Sbjct: 156 GSFHTVTSNQEKDLLFSHIKHESDLPLGLSPADTNISNATSI 197


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,404,417
Number of Sequences: 5004
Number of extensions: 47894
Number of successful extensions: 110
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 108
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 109
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 279695522
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -