SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B16
         (656 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC830.04c |mug128||sequence orphan|Schizosaccharomyces pombe|c...    27   2.4  
SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyce...    27   2.4  
SPBC146.05c |cwf25||complexed with Cdc5 protein Cwf25 |Schizosac...    27   3.1  
SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo...    26   4.2  
SPAC24H6.03 |cul3|pcu3|cullin 3|Schizosaccharomyces pombe|chr 1|...    26   4.2  
SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyc...    26   4.2  
SPCC1393.05 |||sequence orphan|Schizosaccharomyces pombe|chr 3||...    25   9.6  

>SPCC830.04c |mug128||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 143

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +3

Query: 243 YYIRKQEPVDLVERLLEQRALVAEAVRRLKEKKQ 344
           + I+K++P + + +LLEQ   +AE+   +  KKQ
Sbjct: 88  FSIKKRKPHNHIPQLLEQCTCIAESFEGIYTKKQ 121


>SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 496

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = -2

Query: 193 RVSSSIGGNLLEGNCLLSCSVLWRFSQLDFSLSIVVKVLILKFVSHETRRLTGNV 29
           ++ +++G N  +  CL SCS     + L  S  IVV    +K  + +  R+TG V
Sbjct: 426 KIQANLGWNERQRQCLSSCSSHLSLA-LQKSSDIVVAAEEVKLATEDIGRVTGAV 479


>SPBC146.05c |cwf25||complexed with Cdc5 protein Cwf25
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 376

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +3

Query: 138 QDRRQLPSNRLPPIEELTLGLKQKLH-LQARARAAPYYIRKQEPVDLVERLLEQRALVAE 314
           +D+ +  +N L   E + L     L   QA+ R  P    KQ+    ++ L+E+R    +
Sbjct: 103 KDKIEDQNNSLEKTEFIALQNANSLQDTQAKLRLDPLLAIKQQEQKQLQTLMEKRKYSLD 162

Query: 315 AVRRLKEKK 341
           + R+ KE++
Sbjct: 163 SDRKSKERR 171


>SPCC18.03 |||shuttle craft like transcriptional
           regulator|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1077

 Score = 26.2 bits (55), Expect = 4.2
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +3

Query: 321 RRLKEKKQPCHEISVDS*FINKTFYL*KCGTCCEI---ACVYETCR 449
           R + E K   +E SV +  IN +  +  CGTC  +   +C+ + C+
Sbjct: 185 RMIVELKNRLYECSVCTDTINPSTSIWSCGTCYHVFHLSCIRKWCK 230


>SPAC24H6.03 |cul3|pcu3|cullin 3|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 785

 Score = 26.2 bits (55), Expect = 4.2
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = -1

Query: 164 IRRQLPPVLLCTMAIFTAGFLSQHSGKSL 78
           I+   P VLL  +  FT  +LS+H+G+ L
Sbjct: 558 IKCNFPKVLLAQIDQFTDFYLSKHTGRKL 586


>SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1238

 Score = 26.2 bits (55), Expect = 4.2
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -3

Query: 504 VTDSHPFLARSPHIAPL*SDTFHTHKRFHNMFHT 403
           V D  PF+  +P+   L  D+F TH    ++ H+
Sbjct: 727 VPDKSPFVHAAPNSKALTKDSFSTHISVSSLLHS 760


>SPCC1393.05 |||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 956

 Score = 25.0 bits (52), Expect = 9.6
 Identities = 13/47 (27%), Positives = 21/47 (44%)
 Frame = +3

Query: 117 ENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRK 257
           +N  S  ++      N+LP I++  LG     H Q +  A  + I K
Sbjct: 400 QNNPSNFEEMIMNKLNKLPTIDKQILGTSSLTHFQDKTTAIEHSINK 446


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,558,714
Number of Sequences: 5004
Number of extensions: 49476
Number of successful extensions: 146
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 143
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 146
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 297805304
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -