SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B15
         (511 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces...    99   3e-22
SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple...    28   0.93 
SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa...    27   1.2  
SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ...    27   2.2  
SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|...    26   3.8  
SPBC16E9.16c |||sequence orphan|Schizosaccharomyces pombe|chr 2|...    25   8.7  

>SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 118

 Score = 99.1 bits (236), Expect = 3e-22
 Identities = 46/62 (74%), Positives = 55/62 (88%)
 Frame = +1

Query: 142 EKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRK 321
           +K Q   S +HRIRITLTSRNVR+LEKVC+DL+N AK ++LRVKGPVR+PTKIL+ITTRK
Sbjct: 8   QKEQQIPSTVHRIRITLTSRNVRNLEKVCSDLVNRAKDKQLRVKGPVRLPTKILKITTRK 67

Query: 322 TP 327
           TP
Sbjct: 68  TP 69



 Score = 91.5 bits (217), Expect = 7e-20
 Identities = 42/51 (82%), Positives = 47/51 (92%)
 Frame = +2

Query: 320 KLLGGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIA 472
           K   GEGSKTW+ ++MRIHKR+IDLHSPSEIVKQITSI+IEPGVEVEVTIA
Sbjct: 67  KTPNGEGSKTWETYEMRIHKRLIDLHSPSEIVKQITSIHIEPGVEVEVTIA 117


>SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex
            subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1522

 Score = 27.9 bits (59), Expect = 0.93
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +1

Query: 124  VSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVK 273
            +S   IEKP+A  SPIH       +  +R L+ V      GA++ +  VK
Sbjct: 891  LSSSLIEKPRASSSPIHH----ANNNGLRLLKDVLKKTYRGARENRSSVK 936


>SPBC649.05 |cut12|stf1|spindle pole body protein Cut12
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 548

 Score = 27.5 bits (58), Expect = 1.2
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +1

Query: 115 AAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRS 213
           A V +  D+EKPQ +V+   R+   L S N R+
Sbjct: 491 ANVTTSADVEKPQVKVATSSRVDYDLKSPNQRT 523


>SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1854

 Score = 26.6 bits (56), Expect = 2.2
 Identities = 10/14 (71%), Positives = 11/14 (78%)
 Frame = +3

Query: 135 RHRETPGRGLPYSP 176
           R  ETPGR LP+SP
Sbjct: 163 RANETPGRNLPFSP 176


>SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 841

 Score = 25.8 bits (54), Expect = 3.8
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +2

Query: 365 MRIHKRVIDLHSPSEIVKQITSINIEPGV 451
           +R+H+R I L + S+ ++   + NIE G+
Sbjct: 406 LRVHERAIKLRTLSDSIRADVAENIEMGI 434


>SPBC16E9.16c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 642

 Score = 24.6 bits (51), Expect = 8.7
 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 1/27 (3%)
 Frame = -2

Query: 96  IPAEINNFSNQKLFSAEPEKPH-VSSN 19
           + +E N+    KL++ EP  PH V++N
Sbjct: 481 VESEYNSVKGSKLYTTEPVHPHAVTTN 507


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,129,418
Number of Sequences: 5004
Number of extensions: 43673
Number of successful extensions: 120
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 112
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 120
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 204242806
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -