SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP22H7.08 |rps1002|rps10-2, rps10B|40S ribosomal protein S10|S...   152   4e-38
SPAC31G5.17c |rps1001|rps10-1|40S ribosomal protein S10|Schizosa...   146   1e-36
SPAC27D7.06 |||electron transfer flavoprotein alpha subunit|Schi...    26   4.3  
SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharo...    25   7.5  
SPAC16.02c |srp2||mRNA export factor Srp2|Schizosaccharomyces po...    25   7.5  
SPCC24B10.21 |tpi1|tpi|triosephosphate isomerase|Schizosaccharom...    25   7.5  
SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster ...    25   7.5  

>SPBP22H7.08 |rps1002|rps10-2, rps10B|40S ribosomal protein
           S10|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 147

 Score =  152 bits (368), Expect = 4e-38
 Identities = 81/156 (51%), Positives = 105/156 (67%), Gaps = 1/156 (0%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           ML+PK+NR AI++ LF++GV+VAKKD++ PKH E+  +PNLQVIKA QSL SRGY+K ++
Sbjct: 1   MLIPKENRKAIHQALFQQGVLVAKKDFNLPKHPEVG-VPNLQVIKACQSLDSRGYLKTRY 59

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
            W  FY+ LTNEG+EYLR +LHLP E+VPAT KR VR    R    GRP+   RS+   +
Sbjct: 60  NWGWFYYTLTNEGVEYLREYLHLPAEVVPATHKRQVRPAAPR---AGRPEPRERSSAADA 116

Query: 416 AYRRTPAAPGVAPHDKKAD-VGPGSADLEFKGGYGR 520
            YRR          +KK D   PG     F+GG+GR
Sbjct: 117 GYRRA---------EKKDDGAAPGGFAPSFRGGFGR 143


>SPAC31G5.17c |rps1001|rps10-1|40S ribosomal protein
           S10|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 144

 Score =  146 bits (355), Expect = 1e-36
 Identities = 78/155 (50%), Positives = 101/155 (65%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           ML+PK+NR AI++ LF +GV+VAKKD++ PKH E+  +PNLQVIKA QSL SRGY+K ++
Sbjct: 1   MLIPKENRKAIHQALFSQGVLVAKKDFNLPKHPEVG-VPNLQVIKACQSLDSRGYLKTRY 59

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
            W  FY+ LTNEG+EYLR +LHLP E+VPAT KR VR    R    GRP+   R++ D +
Sbjct: 60  NWGWFYYTLTNEGVEYLREYLHLPAEVVPATHKRQVRPTAPR---AGRPEPRERASAD-A 115

Query: 416 AYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGR 520
            YRR           K     P      F+GG+GR
Sbjct: 116 GYRRA--------EKKDEGAAPSGFAPSFRGGFGR 142


>SPAC27D7.06 |||electron transfer flavoprotein alpha
           subunit|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 341

 Score = 25.8 bits (54), Expect = 4.3
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 414 DLSSAERAGASGRPTGPRRT 355
           DLSSAER  A GRP   + T
Sbjct: 221 DLSSAERVVAGGRPLKDKET 240


>SPAC29A4.11 |rga3||GTPase activating protein
           Rga3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 969

 Score = 25.0 bits (52), Expect = 7.5
 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = +3

Query: 138 MHRSILN*RRFLTSKLSKLCNHSSPEVM-SKN 230
           +H + L+  RFL + L ++C H+   +M SKN
Sbjct: 895 LHPAHLSVFRFLIAHLGRVCKHAEKNLMNSKN 926


>SPAC16.02c |srp2||mRNA export factor Srp2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 365

 Score = 25.0 bits (52), Expect = 7.5
 Identities = 12/38 (31%), Positives = 19/38 (50%)
 Frame = +2

Query: 380 PDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSAD 493
           P+A   S+    +Y +  A+    P    +DVG GSA+
Sbjct: 321 PEASMESSAPTESYDKPAASEEQQPLQNHSDVGNGSAE 358


>SPCC24B10.21 |tpi1|tpi|triosephosphate
           isomerase|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 249

 Score = 25.0 bits (52), Expect = 7.5
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = -1

Query: 336 RLSVAGTISGGRCKNILKY 280
           R+   G+++GG CK  LK+
Sbjct: 205 RVIYGGSVNGGNCKEFLKF 223


>SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster
           type |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 827

 Score = 25.0 bits (52), Expect = 7.5
 Identities = 13/36 (36%), Positives = 17/36 (47%)
 Frame = +2

Query: 308 PEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
           P I P ++   V   TVR G    PD P+ S   R+
Sbjct: 791 PFIQPPSMTNQVAYPTVRDGSNNSPDHPSSSNSKRT 826


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,172,486
Number of Sequences: 5004
Number of extensions: 41942
Number of successful extensions: 124
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 119
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 121
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 233995432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -