SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B13
         (639 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe...   122   3e-29
SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces pom...    25   7.0  

>SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces
           pombe|chr mitochondrial|||Manual
          Length = 537

 Score =  122 bits (295), Expect = 3e-29
 Identities = 71/183 (38%), Positives = 90/183 (49%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PGS  L G+ Q+YN  ++AH                  N LVPL++GAPD+A+P
Sbjct: 43  RMELSAPGSQFLSGNGQLYNVAISAHGILMIFFFIIPALFGAFGNYLVPLMIGAPDVAYP 102

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           R+NN  F              + E G G G TVYPPLSS  +H G ++DLAI SL L GI
Sbjct: 103 RVNNFTFWLLPPALMLLLISALTEEGPGGGWTVYPPLSSITSHSGPAIDLAILSLQLTGI 162

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                   S  Q+PLF  A+ IT+          AG + +L +DRNL
Sbjct: 163 SSTLGSVNLIATMINMRAPGLSLYQMPLFAWAIMITSILLLLTLPVLAGGLFMLFSDRNL 222

Query: 629 NTS 637
           NTS
Sbjct: 223 NTS 225


>SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 762

 Score = 25.4 bits (53), Expect = 7.0
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +1

Query: 292 TPTPLPYIINFKKNCRKWCRNRMNS 366
           T T   YIINFKKN   + R +++S
Sbjct: 512 TKTTEEYIINFKKNSWLFFRKKIDS 536


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,808,164
Number of Sequences: 5004
Number of extensions: 27781
Number of successful extensions: 55
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 53
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 285732116
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -