SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B12
         (402 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB17E12.05 |rpl3703|rpl37|60S ribosomal protein L37|Schizosac...   101   4e-23
SPCC1223.05c |rpl3702|rpl37-2, rpl37|60S ribosomal protein L37|S...   100   1e-22
SPAC144.18 |||nucleotide sugar transporter |Schizosaccharomyces ...    27   1.4  
SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3 B...    25   4.4  
SPAC16.03c |ura2||dihydroorotase Ura2 |Schizosaccharomyces pombe...    25   4.4  
SPAPB8E5.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    25   5.8  

>SPAPB17E12.05 |rpl3703|rpl37|60S ribosomal protein
           L37|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 89

 Score =  101 bits (242), Expect = 4e-23
 Identities = 43/72 (59%), Positives = 51/72 (70%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NK+HT+CRRCG+ S+HIQKS CA CGYPAAK RSY+W  KA          M +LK V R
Sbjct: 13  NKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGRMSYLKKVHR 72

Query: 248 RFRNGFKEGKPT 283
            F+NGF+ GKPT
Sbjct: 73  SFKNGFRAGKPT 84


>SPCC1223.05c |rpl3702|rpl37-2, rpl37|60S ribosomal protein
           L37|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 91

 Score =  100 bits (239), Expect = 1e-22
 Identities = 44/79 (55%), Positives = 52/79 (65%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NK+HT+CRRCG+ S+HIQKS CA CGYPAAK RSY+W  KA          M +LK V R
Sbjct: 13  NKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGRMSYLKKVHR 72

Query: 248 RFRNGFKEGKPTPPKKAVA 304
            F+NGF+ GKP     A A
Sbjct: 73  SFKNGFRSGKPAAAVAASA 91


>SPAC144.18 |||nucleotide sugar transporter |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 345

 Score = 26.6 bits (56), Expect = 1.4
 Identities = 12/38 (31%), Positives = 19/38 (50%)
 Frame = -1

Query: 240 TIFK*RMRPVPVVFLRLAFTDQW*DRNFAAGYPHWAHF 127
           T+F   +  +PV+ +   FT+ W   N A  +P  A F
Sbjct: 197 TMFYNNLLSIPVLVICTLFTEDWSAENIAQNFPPDAKF 234


>SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3
           Brl1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 692

 Score = 25.0 bits (52), Expect = 4.4
 Identities = 10/28 (35%), Positives = 11/28 (39%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYP 151
           N  H  C  C    Y  + S C QC  P
Sbjct: 654 NCGHAFCSNCMEPFYEHKTSTCPQCETP 681


>SPAC16.03c |ura2||dihydroorotase Ura2 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 337

 Score = 25.0 bits (52), Expect = 4.4
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = -1

Query: 99  PHLLHNVWVLFRRLPKLEVPLRHLVTLD 16
           P  L  +  L +R PKL++ L H  T D
Sbjct: 148 PKFLPTLLDLHQRFPKLKIVLEHCTTAD 175


>SPAPB8E5.08 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 103

 Score = 24.6 bits (51), Expect = 5.8
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 3/39 (7%)
 Frame = -3

Query: 352 LVFLIFIYLAHIDS*RSYSLLGRRWFPFFKT---ITEAP 245
           L+  IFIYL+  +    Y +L  R F  +KT   IT+ P
Sbjct: 13  LLPFIFIYLSVANKIMFYCILNERAFKHYKTYRRITDCP 51


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,357,969
Number of Sequences: 5004
Number of extensions: 24958
Number of successful extensions: 51
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 51
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 136158338
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -