SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B11
         (654 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC6G10.11c |ubi3||ribosomal ubiquitin fusion protein Ubi3|Schi...   195   4e-51
SPAC589.10c |||ribomal-ubiquitin fusion protein Ubi5|Schizosacch...   195   4e-51
SPAC1805.12c |uep1|ubi2|ribosomal-ubiquitin fusion protein Ubi2|...   135   5e-33
SPAC11G7.04 |ubi1||ribosomal-ubiquitin fusion protein Ubi1|Schiz...   135   5e-33
SPBC337.08c |ubi4||ubiquitin|Schizosaccharomyces pombe|chr 2|||M...   135   5e-33
SPBC12D12.08c |ned8|nedd8, ubl1, SPBC24C6.01c|ubiquitin-like pro...    84   2e-17
SPAC6G9.08 |ubp6||ubiquitin C-terminal hydrolase Ubp6|Schizosacc...    41   1e-04
SPBC2D10.12 |rhp23||Rad23 homolog Rhp23|Schizosaccharomyces pomb...    39   5e-04
SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyc...    38   0.001
SPBC31E1.03 |hub1|ubl4|ubiquitin-like protein modifier Hub1|Schi...    31   0.19 
SPAC227.15 |||protein phosphatase regulatory subunit Reg1 |Schiz...    29   0.44 
SPAC29B12.06c |rcd1||RNA-binding protein Rcd1 |Schizosaccharomyc...    27   3.1  
SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch...    26   5.5  

>SPAC6G10.11c |ubi3||ribosomal ubiquitin fusion protein
           Ubi3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 150

 Score =  195 bits (476), Expect = 4e-51
 Identities = 97/148 (65%), Positives = 111/148 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVK+KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            K Y+TP          +LAVL++YKV+++G + RLRRE
Sbjct: 61  IQKESTLHLVLRLRGGGKKRKKKTYTTPKKIKHKHKKVELAVLKYYKVEDDGSVKRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTM 184
           C    CGA  FMA  +DR YCG+CH T+
Sbjct: 121 C--PNCGASTFMANHKDRLYCGRCHLTL 146


>SPAC589.10c |||ribomal-ubiquitin fusion protein
           Ubi5|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 150

 Score =  195 bits (476), Expect = 4e-51
 Identities = 97/148 (65%), Positives = 111/148 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVK+KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            K Y+TP          +LAVL++YKV+++G + RLRRE
Sbjct: 61  IQKESTLHLVLRLRGGGKKRKKKTYTTPKKIKHKHKKVELAVLKYYKVEDDGSVKRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTM 184
           C    CGA  FMA  +DR YCG+CH T+
Sbjct: 121 C--PNCGASTFMANHKDRLYCGRCHLTL 146


>SPAC1805.12c |uep1|ubi2|ribosomal-ubiquitin fusion protein
           Ubi2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 128

 Score =  135 bits (327), Expect = 5e-33
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVK+KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>SPAC11G7.04 |ubi1||ribosomal-ubiquitin fusion protein
           Ubi1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 128

 Score =  135 bits (327), Expect = 5e-33
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVK+KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>SPBC337.08c |ubi4||ubiquitin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 382

 Score =  135 bits (327), Expect = 5e-33
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVK+KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 5e-33
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVK+KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 5e-33
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVK+KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 5e-33
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVK+KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  135 bits (327), Expect = 5e-33
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVK+KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374


>SPBC12D12.08c |ned8|nedd8, ubl1, SPBC24C6.01c|ubiquitin-like
           protein modifier Ned8|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 78

 Score = 83.8 bits (198), Expect = 2e-17
 Identities = 35/70 (50%), Positives = 52/70 (74%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I L+++P+D +  +K ++++KEGIPP+QQRL +AGKQ+ D +    Y+
Sbjct: 1   MLIKVKTLTGKEIELDIDPNDKVSRIKERVEEKEGIPPSQQRLIYAGKQMADDKNAESYH 60

Query: 447 IQKESTLHLV 418
           ++  S LHLV
Sbjct: 61  LEGGSVLHLV 70


>SPAC6G9.08 |ubp6||ubiquitin C-terminal hydrolase
           Ubp6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 467

 Score = 41.1 bits (92), Expect = 1e-04
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = -1

Query: 600 GKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           GK   LE+EP++T   +K ++     +PP +Q++   G QL+D   L    I+  +TL
Sbjct: 10  GKKYDLEIEPNETGSTLKHQLYSLTQVPPERQKVIVKGGQLKDDVLLGSVGIKPNATL 67


>SPBC2D10.12 |rhp23||Rad23 homolog Rhp23|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 368

 Score = 39.1 bits (87), Expect = 5e-04
 Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 1/65 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDT-IENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M +  K L  +   +    +DT I  +K KIQ ++     +Q+L ++G+ L D +T+ +Y
Sbjct: 1   MNLTFKNLQQQKFVISDVSADTKISELKEKIQTQQNYEVERQKLIYSGRILADDKTVGEY 60

Query: 450 NIQKE 436
           NI+++
Sbjct: 61  NIKEQ 65


>SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 354

 Score = 38.3 bits (85), Expect = 0.001
 Identities = 19/70 (27%), Positives = 35/70 (50%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + + +K    +   + V+   ++  +K  I     I   +QRL +AG+ L+D  +L  Y 
Sbjct: 4   ISLTIKAANDQKYAVTVDSESSVLALKEAIAPVADIEKERQRLIYAGRVLKDEESLKTYK 63

Query: 447 IQKESTLHLV 418
           IQ   ++HLV
Sbjct: 64  IQDGHSIHLV 73


>SPBC31E1.03 |hub1|ubl4|ubiquitin-like protein modifier
           Hub1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 73

 Score = 30.7 bits (66), Expect = 0.19
 Identities = 16/69 (23%), Positives = 31/69 (44%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++      GK + ++  P DT+ + K  +  + G  P +  L       +D  TL+DY 
Sbjct: 2   IEVLCNDRLGKKVRVKCMPDDTVGDFKKLVAAQTGTDPRRIVLKKWHSVFKDNITLADYE 61

Query: 447 IQKESTLHL 421
           I    +L +
Sbjct: 62  IHDGMSLEM 70


>SPAC227.15 |||protein phosphatase regulatory subunit Reg1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 873

 Score = 29.5 bits (63), Expect = 0.44
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = +1

Query: 106 NPSYTAVASVSYRLXGTYLFVVVFEXHRAVTLPAV 210
           NP+YT     SY L  TYL    F+ HR  +  AV
Sbjct: 144 NPAYTNSHQNSYSLNETYLSYDFFDNHRGASSSAV 178


>SPAC29B12.06c |rcd1||RNA-binding protein Rcd1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 283

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 1/54 (1%)
 Frame = -1

Query: 324 VLRFY-KVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHSTMVFKDDD 166
           V+R Y ++ +N +     R C  E      F  V++D H   KC + ++    D
Sbjct: 224 VIRCYLRLSDNPRAREALRHCLPEPLRDATFAQVLKDDHNTKKCLAQLLINLSD 277


>SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit
           Rev3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1480

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -1

Query: 516 PNQQRLXFAGKQLEDGRTLSDYNI 445
           PNQ     AGK+L+  R L DY+I
Sbjct: 476 PNQGDTRKAGKRLKYSRNLDDYHI 499


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,105,051
Number of Sequences: 5004
Number of extensions: 36848
Number of successful extensions: 87
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 80
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 85
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 295793106
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -