SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B08
         (510 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1683.11c |||isocitrate lyase|Schizosaccharomyces pombe|chr 2...    28   0.93 
SPBC1683.13c |||transcription factor |Schizosaccharomyces pombe|...    27   1.2  
SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c...    26   2.9  
SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|...    26   2.9  
SPCC417.10 |||membrane transporter|Schizosaccharomyces pombe|chr...    26   2.9  
SPBC12C2.02c |ste20|ste16|sterility protein Ste20|Schizosaccharo...    25   8.7  

>SPBC1683.11c |||isocitrate lyase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 518

 Score = 27.9 bits (59), Expect = 0.93
 Identities = 22/101 (21%), Positives = 44/101 (43%), Gaps = 4/101 (3%)
 Frame = +3

Query: 87  ITKQNGP*AENAYRQRDRQ*KHHNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVP 266
           +TK   P ++ A +  D   +H N+G  T  Y G   P+     +   L    V  C   
Sbjct: 46  VTKAYYPSSQQALKLYDLLREHRNKGTATLTY-GVVDPVLASQASKAGLETIFVSGCLCG 104

Query: 267 DNPINKTSLNHED-NWRT---AIENTIK*QHYPSKVRHNLH 377
            + +++  ++H D  W T   A++   + Q++ ++ +   H
Sbjct: 105 LSSVDEPGMDHADYPWDTVPKAVDRIFRSQNWHARRQKQFH 145


>SPBC1683.13c |||transcription factor |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 618

 Score = 27.5 bits (58), Expect = 1.2
 Identities = 15/53 (28%), Positives = 26/53 (49%)
 Frame = +3

Query: 126 RQRDRQ*KHHNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPDNPINK 284
           + + RQ K + E       + ++R I C  L PC   ++S   C  P++PI +
Sbjct: 2   QMKPRQDKKNQEIFRISCQRCRQRKIKCDRLHPCFQCVKSNSQCFYPEDPIRR 54


>SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 865

 Score = 26.2 bits (55), Expect = 2.9
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = -2

Query: 218 QGATGYWSSFSLVVLGTFPLIVMFLLA 138
           Q  TG W+   +V+   F ++V+FLLA
Sbjct: 146 QNVTGNWTWAHVVICYVFNVLVLFLLA 172


>SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1184

 Score = 26.2 bits (55), Expect = 2.9
 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 1/19 (5%)
 Frame = -1

Query: 270 YLEH-SRATHYEDEESKEP 217
           Y EH +  +HYE+EE +EP
Sbjct: 782 YFEHETEPSHYEEEEEEEP 800


>SPCC417.10 |||membrane transporter|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 508

 Score = 26.2 bits (55), Expect = 2.9
 Identities = 16/35 (45%), Positives = 17/35 (48%)
 Frame = +3

Query: 201 ISCGTLAPCSLHLRSVWLCCVPDNPINKTSLNHED 305
           I CG LA   + L  V L  VPDNP     L  ED
Sbjct: 227 IICGVLA---IFLGFVILAVVPDNPFKAWFLTEED 258


>SPBC12C2.02c |ste20|ste16|sterility protein
           Ste20|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1309

 Score = 24.6 bits (51), Expect = 8.7
 Identities = 9/31 (29%), Positives = 16/31 (51%)
 Frame = +1

Query: 130 NEIASKNITMRGNVPKTTKEKEDQYPVAPWL 222
           N  +S++    G  P + +    Q+P+ PWL
Sbjct: 188 NNSSSEDTQPNGKRPSSLQSNFSQFPLNPWL 218


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,131,645
Number of Sequences: 5004
Number of extensions: 44104
Number of successful extensions: 114
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 112
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 114
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 204242806
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -