SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B07
         (652 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC4G8.05 |ppk14||serine/threonine protein kinase Ppk14 |Schizo...    28   1.3  
SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces ...    27   1.8  
SPBC20F10.04c |nse4|rad62|Smc5-6 complex non-SMC subunit Nse4|Sc...    26   4.1  
SPCC18B5.11c |cds1||replication checkpoint kinase Cds1|Schizosac...    26   5.4  
SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr 3|||M...    26   5.4  
SPAC328.05 |||RNA-binding protein involved in export of mRNAs|Sc...    25   7.2  
SPAC1399.01c |||purine permease |Schizosaccharomyces pombe|chr 1...    25   7.2  
SPCC970.01 |rad16|rad10, rad20, swi9|DNA repair endonuclease XPF...    25   9.5  
SPCC825.04c |||N-acetyltransferase |Schizosaccharomyces pombe|ch...    25   9.5  

>SPAC4G8.05 |ppk14||serine/threonine protein kinase Ppk14
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 566

 Score = 27.9 bits (59), Expect = 1.3
 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 10/62 (16%)
 Frame = +2

Query: 131 EIVFSTYADSDSLERLCQFLVDVLIYGAQTRRLTEKVR----------RETQWAVLIYSS 280
           +++F  YAD+ S+  LC+ L+  L+   +  RL  +            +  QWA+L ++ 
Sbjct: 438 DVIFPEYADAPSISSLCKNLIRKLLVKDENDRLGSQAGAADVKLHPFFKNVQWALLRHTE 497

Query: 281 SP 286
            P
Sbjct: 498 PP 499


>SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 582

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%)
 Frame = -3

Query: 314 PSANPSLATKGSTSKLTQP-TEFLAGPSQ 231
           PS +PS A   +T+ +T+P T F+ G SQ
Sbjct: 78  PSLSPSSAQSHNTALITEPLTSFIGGTSQ 106


>SPBC20F10.04c |nse4|rad62|Smc5-6 complex non-SMC subunit
           Nse4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 300

 Score = 26.2 bits (55), Expect = 4.1
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = -1

Query: 448 IGRYTFLM*SKSIQRQYSYLRAPNVITDP 362
           +G  +F    ++IQR+    +APNV+T P
Sbjct: 136 VGPLSFRKKERNIQRRERLQKAPNVLTQP 164


>SPCC18B5.11c |cds1||replication checkpoint kinase
           Cds1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 460

 Score = 25.8 bits (54), Expect = 5.4
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 4/48 (8%)
 Frame = -3

Query: 416 IDTAAVFISQSPKRHYGSSRSLNGAFKY----HKHRSPPSANPSLATK 285
           ID     +  +P++    S +L   + Y    H+HR+PPS++   AT+
Sbjct: 407 IDLINRMLEINPEKRISESEALQHPWFYTVSTHEHRTPPSSSEHEATE 454


>SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 535

 Score = 25.8 bits (54), Expect = 5.4
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = -3

Query: 326 HRSPPSANPSLATKGSTSKLTQPTEFLAGPSQ*VFWFEPRKSTRP 192
           +R+ P+  P+    GST  + +PT  L  P   + W + + S  P
Sbjct: 409 NRTLPTDPPNFTNAGSTDPVAEPTAQLLPPDG-LAWIDDKWSISP 452


>SPAC328.05 |||RNA-binding protein involved in export of
           mRNAs|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 434

 Score = 25.4 bits (53), Expect = 7.2
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
 Frame = -3

Query: 392 SQSPKRHYGSSRSLNGAFKYHKHRSPPSANPSLATKGSTSKLTQPTE--FLAGPSQ*VFW 219
           S+SPKRH   S SL     +    +    +P L   G+  K TQ     ++   S  V W
Sbjct: 25  SESPKRHVNGSNSLKRGLHFDGEHT--ERDPHL---GNGQKYTQQERRVYVGNLSYQVRW 79

Query: 218 FE 213
           FE
Sbjct: 80  FE 81


>SPAC1399.01c |||purine permease |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 601

 Score = 25.4 bits (53), Expect = 7.2
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = -1

Query: 259 PLSFSPDLLSESSGLSPVN 203
           P  F PDL ++S GLS  N
Sbjct: 543 PYEFDPDLTNDSPGLSTTN 561


>SPCC970.01 |rad16|rad10, rad20, swi9|DNA repair endonuclease
           XPF|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 892

 Score = 25.0 bits (52), Expect = 9.5
 Identities = 10/34 (29%), Positives = 21/34 (61%)
 Frame = +2

Query: 146 TYADSDSLERLCQFLVDVLIYGAQTRRLTEKVRR 247
           TY + DSL+ +   LVD   +  Q R++++ +++
Sbjct: 412 TYDNKDSLKNMNSKLVDYFQWREQYRKMSKSIKK 445


>SPCC825.04c |||N-acetyltransferase |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 204

 Score = 25.0 bits (52), Expect = 9.5
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +2

Query: 104 YVPRRLRTAEIVFSTYADSDSLERL 178
           Y PRR++T EI   T  D D L+ L
Sbjct: 10  YSPRRMKTQEIKNVTLEDVDFLKNL 34


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,661,427
Number of Sequences: 5004
Number of extensions: 54616
Number of successful extensions: 160
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 157
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 160
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 293780908
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -