SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B05
         (653 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC328.10c |rps502|rps5-2|40S ribosomal protein S5|Schizosaccha...   229   2e-61
SPAC8C9.08 |rps5||40S ribosomal protein S5|Schizosaccharomyces p...   227   1e-60
SPAC16E8.10c |||mitochondrial ribosomal protein subunit S7|Schiz...    38   0.002
SPCC548.05c |||ubiquitin-protein ligase E3 |Schizosaccharomyces ...    29   0.59 
SPBC2G5.03 |||ATP binding protein|Schizosaccharomyces pombe|chr ...    27   1.8  
SPBC8D2.18c |||adenosylhomocysteinase |Schizosaccharomyces pombe...    27   2.4  
SPBC28E12.03 |rga4||GTPase activating protein Rga4|Schizosacchar...    27   3.1  
SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyce...    26   5.5  
SPCC736.08 |cbf11||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual    25   7.2  
SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr...    25   9.5  
SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pom...    25   9.5  

>SPAC328.10c |rps502|rps5-2|40S ribosomal protein
           S5|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 203

 Score =  229 bits (561), Expect = 2e-61
 Identities = 117/181 (64%), Positives = 144/181 (79%)
 Frame = +2

Query: 110 AGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYA 289
           A S++ + +SL +      IKLF ++    V+V D+SL DYI++     + LPH+AGR+ 
Sbjct: 2   AASIIPKEVSLDETG---HIKLFNKFPFEGVEVKDISLVDYITIGN--GQPLPHTAGRFQ 56

Query: 290 HKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAII 469
            KRFRKA+C IVERLTNSLMM+GRNNGKKL+A RIVKHAFEII LLT +NPLQVLV A+ 
Sbjct: 57  TKRFRKARCFIVERLTNSLMMNGRNNGKKLLATRIVKHAFEIIALLTDQNPLQVLVDAVA 116

Query: 470 NSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADEL 649
             GPREDSTRIG AGTVRRQAVDVSPLRRVNQA+ L+  GAREAAFRN+K+I+EC+A+E+
Sbjct: 117 ACGPREDSTRIGSAGTVRRQAVDVSPLRRVNQALALITIGAREAAFRNVKSISECLAEEI 176

Query: 650 I 652
           I
Sbjct: 177 I 177


>SPAC8C9.08 |rps5||40S ribosomal protein S5|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 203

 Score =  227 bits (555), Expect = 1e-60
 Identities = 117/177 (66%), Positives = 140/177 (79%), Gaps = 3/177 (1%)
 Frame = +2

Query: 131 TMSLPQAADIPE---IKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRF 301
           T SL     + E   IKLF ++    V+V D+SL DYI++     + LPH+AGR+  KRF
Sbjct: 3   TSSLTPGVSLDENGSIKLFNKFPFEGVEVKDISLVDYITIGN--GQPLPHTAGRFQTKRF 60

Query: 302 RKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGP 481
           RKA+C IVERLTNSLMM+GRNNGKKL+A RIVKHAFEII LLT +NPLQVLV A+   GP
Sbjct: 61  RKARCFIVERLTNSLMMNGRNNGKKLLATRIVKHAFEIIALLTDQNPLQVLVDAVAACGP 120

Query: 482 REDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           REDSTRIG AGTVRRQAVDVSPLRRVNQA+ L+  GAREAAFRN+K+I+EC+A+E+I
Sbjct: 121 REDSTRIGSAGTVRRQAVDVSPLRRVNQALALITIGAREAAFRNVKSISECLAEEII 177


>SPAC16E8.10c |||mitochondrial ribosomal protein subunit
           S7|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 259

 Score = 37.5 bits (83), Expect = 0.002
 Identities = 23/53 (43%), Positives = 28/53 (52%)
 Frame = +2

Query: 323 VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGP 481
           V+ L N +M     +GKK  A +IV  A  II   TGENP+ VL  AI    P
Sbjct: 126 VQHLVNLIM----RDGKKAKAEKIVATALSIIQKETGENPIDVLKQAIAEISP 174


>SPCC548.05c |||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 468

 Score = 29.1 bits (62), Expect = 0.59
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +1

Query: 382 GRTYCQTCV*NYSLVNWRKPSASTRDCHYQLWT 480
           G TYC  C     L+NW K S S   C  +L+T
Sbjct: 101 GHTYCYEC-----LLNWLKESKSCPTCRQKLYT 128


>SPBC2G5.03 |||ATP binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 335

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = +2

Query: 404 AFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVRRQAVDVSPLRR 556
           + +I HL+TG N   +  T ++N   R D  R+ R+  +  Q+ D SP +R
Sbjct: 159 SLDIHHLVTGHNADDIAETILMNL-LRGDVARLPRSTEITTQS-DSSPTKR 207


>SPBC8D2.18c |||adenosylhomocysteinase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +2

Query: 146 QAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYA 289
           + ADI  +  FGR    ++++++  +   I+V+EKYAK  P    R A
Sbjct: 7   KVADI-SLAAFGR---KELEIAENEMPGLIAVREKYAKSQPLKGARIA 50


>SPBC28E12.03 |rga4||GTPase activating protein
           Rga4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 933

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = +3

Query: 474 LDPVKIRLGSVVRVQFVVKPLMFHPCAESTKQSGFCAQV 590
           ++PV  R  SVV    V +P+ +H   +S  ++G   Q+
Sbjct: 273 IEPVSSRQSSVVNNNSVQQPVAYHAFVQSPTENGTLPQL 311


>SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 674

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = +1

Query: 331 PYKLSNDARSEQWQKTDGRTYCQTCV*NYSLVNWRKPSAST 453
           PYK+   +  + W +  G+TY  + +  + L   R+ +AST
Sbjct: 138 PYKIVEHSNGDAWLEARGKTYSPSQIGGFILSKMRE-TAST 177


>SPCC736.08 |cbf11||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 613

 Score = 25.4 bits (53), Expect = 7.2
 Identities = 16/54 (29%), Positives = 28/54 (51%)
 Frame = -1

Query: 308 LYGNACVHTCQLNEVNILRTSL*RKCSPAETYQRLAHRSNSICRKA*FQECRRL 147
           L  N C+    LNE ++ + SL R   P++    ++ R +S+ +K+   E R L
Sbjct: 147 LLNNCCIGIANLNEDSVHKISLTRSGKPSQLV-TVSCRHSSVIQKSYGSEKRYL 199


>SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 131

 Score = 25.0 bits (52), Expect = 9.5
 Identities = 10/15 (66%), Positives = 10/15 (66%)
 Frame = +3

Query: 135 CLYHKPPTFLKSSFS 179
           C  H P TFL SSFS
Sbjct: 117 CFIHPPITFLSSSFS 131


>SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1158

 Score = 25.0 bits (52), Expect = 9.5
 Identities = 14/47 (29%), Positives = 21/47 (44%)
 Frame = +2

Query: 281 RYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIH 421
           +Y  KR   A+  +V R       H R N  KL +  +  H F ++H
Sbjct: 390 KYPRKRQEIAE--LVIRCLQDRSSHVRRNAIKLFSKLLTTHPFSVMH 434


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,732,268
Number of Sequences: 5004
Number of extensions: 56000
Number of successful extensions: 144
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 135
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 142
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 295793106
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -