SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B03
         (549 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC959.08 |rpl2102|rpl21-2, rpl21|60S ribosomal protein L21|Sch...   182   3e-47
SPBC365.03c |rpl2101|rpl21, rpl21-1|60S ribosomal protein L21|Sc...   182   4e-47
SPAC7D4.12c |||DUF1212 family protein|Schizosaccharomyces pombe|...    29   0.60 
SPAC26A3.04 |rpl2002|rpl20, rpl20-2|60S ribosomal protein L20|Sc...    27   2.4  
SPAC3A12.10 |rpl2001|rpl20-1, rpl20, yl17b, rpl18a-2|60S ribosom...    27   2.4  
SPAC17H9.20 |psc3|SPAC607.01|mitotic cohesin complex, non-SMC su...    27   2.4  
SPAC11D3.15 |||oxoprolinase |Schizosaccharomyces pombe|chr 1|||M...    26   3.2  
SPBC21B10.07 |||glycosyl hydrolase family 16|Schizosaccharomyces...    25   5.6  
SPAC4D7.13 |usp104|prp40|U1 snRNP-associated protein Usp104|Schi...    25   5.6  
SPAC17A2.04c |||HSP chaperone complex subunit |Schizosaccharomyc...    25   7.3  
SPAC17G6.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    25   7.3  
SPAC5D6.02c |mug165||sequence orphan|Schizosaccharomyces pombe|c...    25   7.3  
SPCC191.05c |||nucleoside 2-deoxyribosyltransferase |Schizosacch...    25   9.7  
SPAC328.04 |||AAA family ATPase, unknown biological role|Schizos...    25   9.7  
SPBC1773.01 |||striatin homolog|Schizosaccharomyces pombe|chr 2|...    25   9.7  
SPBP35G2.13c |swc2||chromatin remodeling complex subunit Swc2 |S...    25   9.7  
SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces ...    25   9.7  
SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1...    25   9.7  
SPCC1183.11 ||SPCC31H12.01|MS ion channel protein 1|Schizosaccha...    25   9.7  

>SPAC959.08 |rpl2102|rpl21-2, rpl21|60S ribosomal protein
           L21|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 160

 Score =  182 bits (443), Expect = 3e-47
 Identities = 86/132 (65%), Positives = 100/132 (75%), Gaps = 1/132 (0%)
 Frame = +2

Query: 113 RSPRYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRII 292
           R   Y+K YKVGDIVDI+ NGAVQKGMPHK YHGKTG VYNVT  ++GV++ K V  R +
Sbjct: 26  RLSTYLKTYKVGDIVDIKVNGAVQKGMPHKYYHGKTGVVYNVTQSSVGVLIYKVVGNRYM 85

Query: 293 PKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVS-GT 469
            KR+N+R+EHVKHSKCRQDFL RVK NE   KEAKA GKTV L+RQPAPP  AH VS   
Sbjct: 86  EKRVNVRIEHVKHSKCRQDFLDRVKANEAKRKEAKAQGKTVQLRRQPAPPATAHFVSTEN 145

Query: 470 EKPVLLAPIPYE 505
            +PV L P+ Y+
Sbjct: 146 NEPVTLHPVAYD 157


>SPBC365.03c |rpl2101|rpl21, rpl21-1|60S ribosomal protein
           L21|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 160

 Score =  182 bits (442), Expect = 4e-47
 Identities = 86/132 (65%), Positives = 100/132 (75%), Gaps = 1/132 (0%)
 Frame = +2

Query: 113 RSPRYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRII 292
           R   Y+K YKVGDIVDI+ NGAVQKGMPHK YHGKTG VYNVT  ++GV++ K V  R +
Sbjct: 26  RLSTYLKTYKVGDIVDIKVNGAVQKGMPHKYYHGKTGVVYNVTQSSVGVLIYKVVGNRYM 85

Query: 293 PKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVS-GT 469
            KR+N+R+EHVKHSKCRQDFL RVK NE   KEAKA GKTV L+RQPAPP  AH VS   
Sbjct: 86  EKRVNVRIEHVKHSKCRQDFLDRVKANEAKRKEAKAQGKTVQLRRQPAPPAKAHFVSTEN 145

Query: 470 EKPVLLAPIPYE 505
            +PV L P+ Y+
Sbjct: 146 NEPVTLHPVAYD 157


>SPAC7D4.12c |||DUF1212 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 759

 Score = 28.7 bits (61), Expect = 0.60
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 5/69 (7%)
 Frame = -3

Query: 478 GFLSSTDDVGSFRGSWLSLQVDGLAGSL-GFLQ*PL----ILFDSLKEVLSALGVLDMLN 314
           GF S+T    SF+G W+ L +  + G L G LQ  +     +++SL EV  ++ +   L+
Sbjct: 445 GFASATILPMSFQGGWIDLPIAFILGCLVGILQHYIAPRSTMYNSLFEVTGSI-ITSFLS 503

Query: 313 TDIDALRYN 287
               ++RY+
Sbjct: 504 RAFGSIRYS 512


>SPAC26A3.04 |rpl2002|rpl20, rpl20-2|60S ribosomal protein
           L20|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 176

 Score = 26.6 bits (56), Expect = 2.4
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%)
 Frame = +2

Query: 98  HMELFRSPRYMKVYKVGDIVDIRGNGAVQKGMPHKVY---HGKTGRV 229
           H   FRS R +KV +V    D+R N   Q   PH  +   H +TG V
Sbjct: 113 HRARFRSIRILKVVEVEKKEDVRRNYVKQLLNPHLKFPLPHRRTGVV 159


>SPAC3A12.10 |rpl2001|rpl20-1, rpl20, yl17b, rpl18a-2|60S ribosomal
           protein L20a|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 176

 Score = 26.6 bits (56), Expect = 2.4
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%)
 Frame = +2

Query: 98  HMELFRSPRYMKVYKVGDIVDIRGNGAVQKGMPHKVY---HGKTGRV 229
           H   FRS R +KV +V    D+R N   Q   PH  +   H +TG V
Sbjct: 113 HRARFRSIRILKVVEVEKKEDVRRNYVKQLLNPHLKFPLPHRRTGVV 159


>SPAC17H9.20 |psc3|SPAC607.01|mitotic cohesin complex, non-SMC
           subunit Psc3 |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 962

 Score = 26.6 bits (56), Expect = 2.4
 Identities = 9/14 (64%), Positives = 13/14 (92%)
 Frame = -3

Query: 46  EFVIFEPCVTKLDG 5
           EFVIFE C+T+++G
Sbjct: 726 EFVIFEACLTRIEG 739


>SPAC11D3.15 |||oxoprolinase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1317

 Score = 26.2 bits (55), Expect = 3.2
 Identities = 20/55 (36%), Positives = 29/55 (52%)
 Frame = -3

Query: 409 LAGSLGFLQ*PLILFDSLKEVLSALGVLDMLNTDIDALRYNPSANTLVDNHTESM 245
           +A SLG  Q   +L      +LSA G   M   D+ +    PS+ TL D++TES+
Sbjct: 509 IAKSLGITQ---VLVHKYSSILSAYG---MALADVVSEVQEPSSFTLDDSNTESI 557


>SPBC21B10.07 |||glycosyl hydrolase family 16|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 419

 Score = 25.4 bits (53), Expect = 5.6
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -3

Query: 304 DALRYNPSANTLVDNHTES 248
           D  R N S N ++DNHT++
Sbjct: 29  DPARKNESTNDVIDNHTDT 47


>SPAC4D7.13 |usp104|prp40|U1 snRNP-associated protein
           Usp104|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 695

 Score = 25.4 bits (53), Expect = 5.6
 Identities = 10/29 (34%), Positives = 13/29 (44%)
 Frame = +1

Query: 127 HESVQSWRHCRHQRQWCSSKGYATQSIPW 213
           H    SW   +  R+ C +KGY     PW
Sbjct: 205 HNVNPSWTWEQTVRELCDAKGYYVMKDPW 233


>SPAC17A2.04c |||HSP chaperone complex subunit |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 358

 Score = 25.0 bits (52), Expect = 7.3
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = +2

Query: 335 KCRQDFLKRVKENERLLKEAKAAGKTVNLKRQ 430
           K   DF KR  E +R+ +E   A KTV L  Q
Sbjct: 181 KKSDDFEKRESEKKRVAQEKVIAAKTVLLALQ 212


>SPAC17G6.13 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 433

 Score = 25.0 bits (52), Expect = 7.3
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = +2

Query: 389 EAKAAGKTVNLKRQPAPPKAAHIVSGT 469
           + KA  K  +  +QP+PP A H  + T
Sbjct: 344 DTKAGEKLTDSSKQPSPPVAEHFSNET 370


>SPAC5D6.02c |mug165||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 300

 Score = 25.0 bits (52), Expect = 7.3
 Identities = 17/61 (27%), Positives = 30/61 (49%)
 Frame = +3

Query: 297 SASISVLSMSSTPSADKTSLRESKRMRGY*RKPRLPARPST*RDSQLPLKLPTSSVELRN 476
           SAS S  S++S+ S D  ++   +R R   RKP +  +P+  +  + P  + T   +   
Sbjct: 56  SASRSPESIASSQSNDSAAIPSYRRKRRKVRKPEI-VKPTLRKRGRKPKNISTLEHDKSK 114

Query: 477 P 479
           P
Sbjct: 115 P 115


>SPCC191.05c |||nucleoside 2-deoxyribosyltransferase
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 211

 Score = 24.6 bits (51), Expect = 9.7
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -3

Query: 409 LAGSLGFLQ*PLILFDSLKEVLSALGV 329
           LAG L F    + LFD LKE+    GV
Sbjct: 22  LAGDLVFRPNAIELFDELKEICKDAGV 48


>SPAC328.04 |||AAA family ATPase, unknown biological
           role|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 741

 Score = 24.6 bits (51), Expect = 9.7
 Identities = 10/15 (66%), Positives = 14/15 (93%)
 Frame = +3

Query: 318 SMSSTPSADKTSLRE 362
           SMSS+P+A +TSLR+
Sbjct: 163 SMSSSPTASRTSLRK 177


>SPBC1773.01 |||striatin homolog|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 612

 Score = 24.6 bits (51), Expect = 9.7
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%)
 Frame = +2

Query: 356 KRVKENERLLK-EAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           K+ KE +  LK E+     T  +  QP P       SGTE  V+
Sbjct: 269 KKKKEQKWTLKFESDKGTSTQCITHQPLPGSTPSFASGTENGVI 312


>SPBP35G2.13c |swc2||chromatin remodeling complex subunit Swc2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 316

 Score = 24.6 bits (51), Expect = 9.7
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 356 KRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKP 478
           K +++ ER+ K      +  NL+R   PPK     + +E P
Sbjct: 83  KILRDEERIKKRKIQKNRAANLQRTLQPPKRPTPSAASEVP 123


>SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1427

 Score = 24.6 bits (51), Expect = 9.7
 Identities = 7/15 (46%), Positives = 13/15 (86%)
 Frame = -3

Query: 433  WLSLQVDGLAGSLGF 389
            WL+++ DG++G +GF
Sbjct: 1085 WLAIRTDGISGLVGF 1099


>SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 574

 Score = 24.6 bits (51), Expect = 9.7
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 9/47 (19%)
 Frame = +3

Query: 6   PSSFVTQGSKMTNSKGYRRGTRXLVRSQV---------PHTWNYSAL 119
           PSS +TQ  K T  K   + T  ++ + V         P+ WNY+ L
Sbjct: 3   PSSSITQEDKATIRKYIPKSTNKIIAAAVVKLYVAYPDPNKWNYTGL 49


>SPCC1183.11 ||SPCC31H12.01|MS ion channel protein
           1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1011

 Score = 24.6 bits (51), Expect = 9.7
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 14/93 (15%)
 Frame = +2

Query: 137 YKVGDIVDIRGNGAVQKGMPHKV------YHGKTGRVY---NVTAHALGVIVNKRVRGRI 289
           Y VGD VD+  NG V   M  ++      +   TG+V    N   + L ++  +R  G  
Sbjct: 658 YDVGDRVDVMINGTVTSAMVKEISIMSTEFRLLTGKVIQAPNSLLNTLWILNMRRSDGIA 717

Query: 290 IPKRINIR----VEHVKHSKCR-QDFLKRVKEN 373
            P  +N++    ++ ++  + +  DFLK  K +
Sbjct: 718 DPVTVNLKFGTTLQQIEQLRIKIIDFLKEEKRD 750


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,182,990
Number of Sequences: 5004
Number of extensions: 43352
Number of successful extensions: 169
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 165
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 169
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 227943826
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -