SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B02
         (347 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1685.09 |rps29||40S ribosomal protein S29|Schizosaccharomyce...    52   2e-08
SPAC23G3.01 |rpb2|SPAC521.06|DNA-directed RNA polymerase II comp...    28   0.36 
SPBP23A10.05 |ssr4||SWI/SNF and RSC complex subunit Ssr4|Schizos...    25   2.5  
SPAC31A2.04c |||20S proteasome component beta 4|Schizosaccharomy...    24   7.8  
SPAC11E3.01c |swr1|SPAC2H10.03c|SNF2 family helicase Swr1|Schizo...    24   7.8  

>SPBC1685.09 |rps29||40S ribosomal protein S29|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 56

 Score = 52.4 bits (120), Expect = 2e-08
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           C     R GLIRKYGLNI RQ FREYA+DIGF K
Sbjct: 21  CAHTGRRLGLIRKYGLNISRQSFREYANDIGFVK 54



 Score = 40.3 bits (90), Expect = 8e-05
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           M H N+W+SHPR+YG+GSR
Sbjct: 1   MAHENVWFSHPRKYGKGSR 19


>SPAC23G3.01 |rpb2|SPAC521.06|DNA-directed RNA polymerase II complex
            subunit Rpb2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1210

 Score = 28.3 bits (60), Expect = 0.36
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +2

Query: 95   IFGILTLADTDKDLGSCRSCSNRHGLIRKYGLNICRQCFRE 217
            I G++ +A   KD   CRSC NR    + Y     +  F+E
Sbjct: 1154 ICGLIAIASYKKDSYECRSCQNRTRFSQVYLPYAAKLLFQE 1194


>SPBP23A10.05 |ssr4||SWI/SNF and RSC complex subunit
           Ssr4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 395

 Score = 25.4 bits (53), Expect = 2.5
 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 186 PYLRIKPCLLEQDR-HXPRSLSVSARVRIPNICVAHFK 76
           P ++  P LL++ + H P   ++S R  +PN+  A  K
Sbjct: 169 PDVKTSPFLLQEPKKHIPEGTALSQRETLPNMGSAQMK 206


>SPAC31A2.04c |||20S proteasome component beta 4|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 194

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = -3

Query: 165 CLLEQDRHXPRSLSVSARVRIPNICVAHFKK 73
           CL   DR+    L++   VRI  +C    KK
Sbjct: 140 CLSIFDRYYKPDLTIDEAVRIMKLCFDELKK 170


>SPAC11E3.01c |swr1|SPAC2H10.03c|SNF2 family helicase
           Swr1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1288

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = -3

Query: 144 HXPRSLSVSARVRIPNICVAHFKKLN 67
           H  R +  S   RI  + +AHFK+L+
Sbjct: 133 HNDRKVRASRSRRISGMILAHFKRLS 158


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,069,159
Number of Sequences: 5004
Number of extensions: 19012
Number of successful extensions: 47
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47
length of database: 2,362,478
effective HSP length: 64
effective length of database: 2,042,222
effective search space used: 104153322
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -