SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B01
         (653 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe...   131   7e-32
SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces pom...    25   7.2  

>SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces
           pombe|chr mitochondrial|||Manual
          Length = 537

 Score =  131 bits (317), Expect = 7e-32
 Identities = 79/215 (36%), Positives = 99/215 (46%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           I+STN KDI  LY                    EL  PGS  L G+ Q+YN  ++AH   
Sbjct: 12  IFSTNAKDIAILYLLFGLVSGIIGSVFSFIIRMELSAPGSQFLSGNGQLYNVAISAHGIL 71

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N LVPL++GAPD+A+PR+NN  F              + E G G 
Sbjct: 72  MIFFFIIPALFGAFGNYLVPLMIGAPDVAYPRVNNFTFWLLPPALMLLLISALTEEGPGG 131

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPLSS  +H G ++DLAI SL L GISS                   S  Q+PLF
Sbjct: 132 GWTVYPPLSSITSHSGPAIDLAILSLQLTGISSTLGSVNLIATMINMRAPGLSLYQMPLF 191

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
             A+ IT+           G + +L +DRNLNTSF
Sbjct: 192 AWAIMITSILLLLTLPVLAGGLFMLFSDRNLNTSF 226


>SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 762

 Score = 25.4 bits (53), Expect = 7.2
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +3

Query: 303 TPTPLPYIINFKKNCRKWCRNRMNS 377
           T T   YIINFKKN   + R +++S
Sbjct: 512 TKTTEEYIINFKKNSWLFFRKKIDS 536


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,980,301
Number of Sequences: 5004
Number of extensions: 32225
Number of successful extensions: 66
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 62
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 295793106
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -