SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A24
         (653 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1834.04 |hht1||histone H3 h3.1|Schizosaccharomyces pombe|chr...   105   4e-24
SPBC8D2.04 |hht2|h3.2|histone H3 h3.2|Schizosaccharomyces pombe|...   105   4e-24
SPBC1105.11c |hht3|h3.3|histone H3 h3.3|Schizosaccharomyces pomb...   105   4e-24
SPBC1105.17 |cnp1|sim2|CENP-A|Schizosaccharomyces pombe|chr 2|||...    68   1e-12
SPAC3H1.13 |ppk13||serine/threonine protein kinase Ppk13 |Schizo...    27   1.8  
SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog Rhp16|Schizo...    27   1.8  
SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyce...    27   1.8  
SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|...    25   7.2  
SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo...    25   9.5  

>SPAC1834.04 |hht1||histone H3 h3.1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 136

 Score =  105 bits (253), Expect = 4e-24
 Identities = 53/56 (94%), Positives = 54/56 (96%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+AIGALQEA EAYL
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYL 101



 Score = 93.1 bits (221), Expect = 3e-20
 Identities = 42/45 (93%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLA+KAARK+AP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKAAPATGGVKKPHRYRPG 45



 Score = 65.3 bits (152), Expect = 7e-12
 Identities = 31/41 (75%), Positives = 36/41 (87%)
 Frame = +2

Query: 410 QARLISXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           +A L+S  LFEDTNLCAIH KRVTI PKD+QLARR+RGER+
Sbjct: 98  EAYLVS--LFEDTNLCAIHGKRVTIQPKDMQLARRLRGERS 136


>SPBC8D2.04 |hht2|h3.2|histone H3 h3.2|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 136

 Score =  105 bits (253), Expect = 4e-24
 Identities = 53/56 (94%), Positives = 54/56 (96%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+AIGALQEA EAYL
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYL 101



 Score = 93.1 bits (221), Expect = 3e-20
 Identities = 42/45 (93%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLA+KAARK+AP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKAAPATGGVKKPHRYRPG 45



 Score = 65.3 bits (152), Expect = 7e-12
 Identities = 31/41 (75%), Positives = 36/41 (87%)
 Frame = +2

Query: 410 QARLISXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           +A L+S  LFEDTNLCAIH KRVTI PKD+QLARR+RGER+
Sbjct: 98  EAYLVS--LFEDTNLCAIHGKRVTIQPKDMQLARRLRGERS 136


>SPBC1105.11c |hht3|h3.3|histone H3 h3.3|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 136

 Score =  105 bits (253), Expect = 4e-24
 Identities = 53/56 (94%), Positives = 54/56 (96%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+AIGALQEA EAYL
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYL 101



 Score = 93.1 bits (221), Expect = 3e-20
 Identities = 42/45 (93%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLA+KAARK+AP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKAAPATGGVKKPHRYRPG 45



 Score = 65.3 bits (152), Expect = 7e-12
 Identities = 31/41 (75%), Positives = 36/41 (87%)
 Frame = +2

Query: 410 QARLISXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           +A L+S  LFEDTNLCAIH KRVTI PKD+QLARR+RGER+
Sbjct: 98  EAYLVS--LFEDTNLCAIHGKRVTIQPKDMQLARRLRGERS 136


>SPBC1105.17 |cnp1|sim2|CENP-A|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 120

 Score = 68.1 bits (159), Expect = 1e-12
 Identities = 37/65 (56%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQD----FKTD--LXFQSAAIGALQEASEA 420
           T ALREIR+YQ+ST+LLI++LPF R+VREI+ +    F TD  L +QS A+  LQEA+EA
Sbjct: 26  TTALREIRKYQRSTDLLIQRLPFSRIVREISSEFVANFSTDVGLRWQSTALQCLQEAAEA 85

Query: 421 YLXWL 435
           +L  L
Sbjct: 86  FLVHL 90



 Score = 60.1 bits (139), Expect = 3e-10
 Identities = 27/30 (90%), Positives = 29/30 (96%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFEDTNLCAIHAKRVTIM +D+QLARRIRG
Sbjct: 90  LFEDTNLCAIHAKRVTIMQRDMQLARRIRG 119


>SPAC3H1.13 |ppk13||serine/threonine protein kinase Ppk13
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 344

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 15/47 (31%), Positives = 20/47 (42%)
 Frame = +3

Query: 372 AFPVCRHRSSPGGKRGLSRLACSKTPTCVLFTPNV*PSCRRIFNLLD 512
           A  VC  + S   K   S L C     C+   PN  PS R + + +D
Sbjct: 293 ALAVCNAQYSFPRKHPYSTLLCEIVEACLQREPNKRPSARELLSKID 339


>SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog
           Rhp16|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 963

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 238 HIVIALXTVALREIRRYQKSTELLIRKLPFQR 333
           H+   L   A RE+++ ++  EL++  LPFQR
Sbjct: 331 HVWEKLEEEAPREVKQIEQPKELVLNLLPFQR 362


>SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1261

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 3/51 (5%)
 Frame = -2

Query: 541 TNLSTFTTDSSSKLN---ILRHDGHTFGVNSTQVGVFEQAXRDKPRLPPGE 398
           TNLS   T +   L+    L  D   F   S Q+G F+ +  ++ + PPG+
Sbjct: 44  TNLSLSNTKAPGSLDERLFLTEDDIIFHDRSIQLGYFDPSLSERKQSPPGK 94


>SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 612

 Score = 25.4 bits (53), Expect = 7.2
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = -3

Query: 408 LLESSDGGRLEXQISFEILSD 346
           L  + DGG+LE Q+ +++L D
Sbjct: 72  LFTTDDGGKLELQVYYQLLVD 92


>SPCC1739.11c |cdc11||SIN component scaffold protein
           Cdc11|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1045

 Score = 25.0 bits (52), Expect = 9.5
 Identities = 13/49 (26%), Positives = 23/49 (46%)
 Frame = -2

Query: 514 SSSKLNILRHDGHTFGVNSTQVGVFEQAXRDKPRLPPGELRWRQTGXAN 368
           ++S +N  +  G      ST+ G F++   D P +P    +W+Q    N
Sbjct: 31  TTSNVNNTQSTGRGSSGTSTEHGTFKKGRNDAPDVP----QWKQVNAKN 75


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,200,403
Number of Sequences: 5004
Number of extensions: 38382
Number of successful extensions: 112
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 98
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 111
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 295793106
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -