SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A23
         (527 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC649.02 |rps1902|rps19-2, rps19|40S ribosomal protein S19|Sch...    99   2e-22
SPBC21C3.13 |rps1901|rps19-1|40S ribosomal protein S19|Schizosac...    99   2e-22
SPBC27B12.05 |||WD repeat protein|Schizosaccharomyces pombe|chr ...    25   9.2  

>SPBC649.02 |rps1902|rps19-2, rps19|40S ribosomal protein
           S19|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 143

 Score =   99 bits (238), Expect = 2e-22
 Identities = 45/84 (53%), Positives = 60/84 (71%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+YVR AAI RHIY+R  VGV  + K++GG    G+ PSH    SGS+ RK +QSLE + 
Sbjct: 52  WYYVRAAAIARHIYLRKQVGVGRLCKVYGGSVNRGMRPSHHRDGSGSVQRKVVQSLEKIG 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIA 440
           ++EK  +GGR ++ QG+RDLDRIA
Sbjct: 112 VLEKSDNGGRRISQQGQRDLDRIA 135



 Score = 58.4 bits (135), Expect = 6e-10
 Identities = 25/50 (50%), Positives = 35/50 (70%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           M  V+VKDV+  + +   AA LK++GK+  P+ +D+VKT   KELAPYDP
Sbjct: 1   MAGVSVKDVDAQQFINAYAAFLKRSGKMTTPQWIDIVKTGTHKELAPYDP 50


>SPBC21C3.13 |rps1901|rps19-1|40S ribosomal protein
           S19|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 144

 Score =   99 bits (238), Expect = 2e-22
 Identities = 45/84 (53%), Positives = 60/84 (71%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+YVR AAI RHIY+R  VGV  + K++GG    G+ PSH    SGS+ RK +QSLE + 
Sbjct: 52  WYYVRAAAIARHIYLRKQVGVGRLCKVYGGSVNRGMRPSHHRDGSGSVQRKVVQSLEKIG 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIA 440
           ++EK  +GGR ++ QG+RDLDRIA
Sbjct: 112 VLEKSDNGGRRISQQGQRDLDRIA 135



 Score = 59.7 bits (138), Expect = 3e-10
 Identities = 26/50 (52%), Positives = 35/50 (70%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           M  V+VKDV+  K +   AA LK++GK+  P+ +D+VKT   KELAPYDP
Sbjct: 1   MAGVSVKDVDAQKFITAYAAFLKRSGKMTTPQWIDIVKTGTHKELAPYDP 50


>SPBC27B12.05 |||WD repeat protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 391

 Score = 24.6 bits (51), Expect = 9.2
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 4/35 (11%)
 Frame = -1

Query: 425 VSSTLCGENATT----VLNFLNKLQCLQRLQSLAC 333
           VSS  C E   T     L+ +N ++C+  LQS+ C
Sbjct: 261 VSSKNCFEEPITPRFQALHRINMIECIPELQSVVC 295


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,049,336
Number of Sequences: 5004
Number of extensions: 39327
Number of successful extensions: 105
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 102
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 105
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 216376042
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -