SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A19
         (601 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1739.08c |||short chain dehydrogenase|Schizosaccharomyces po...    27   2.1  
SPCC622.13c |||conserved eukaryotic protein|Schizosaccharomyces ...    27   2.8  
SPBC11C11.04c |alp1||tubulin specific chaperone cofactor D |Schi...    25   8.5  

>SPCC1739.08c |||short chain dehydrogenase|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 261

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 11/38 (28%), Positives = 24/38 (63%)
 Frame = -2

Query: 165 SHLID*YALRGRHVLVSNHGRMI*YLIKTAFFEKGQEI 52
           +H++D ++L+G++ +V    + I + I TAF + G  +
Sbjct: 11  AHVLDLFSLKGKNCVVFGAAKGIGFSIATAFAQAGGNV 48


>SPCC622.13c |||conserved eukaryotic protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1098

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 26/119 (21%), Positives = 52/119 (43%), Gaps = 1/119 (0%)
 Frame = +1

Query: 55  FLALFKESCFN*ILDHAAMIRN*NMSSPQSVSVDQMRQILNEIIDALESPDYASKLDEAK 234
           +++ F E+C        A+  N N S+P  +  + +  ++N +   L + D + +L    
Sbjct: 606 YVSSFAEACIQ------AIATNCNYSTPAELLRENIDYVVNSVALKLNTLDVSPQLPIVM 659

Query: 235 E-AAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQFTQLIRDLESIDGEVARL 408
                N+    ++ +  +V  I      +HG+    EG++     I   ESI+GE  +L
Sbjct: 660 AYVIKNDDGGCIRYIGDVVDAIFGILDAYHGYARLTEGLLGILYAIIKQESINGEEKKL 718


>SPBC11C11.04c |alp1||tubulin specific chaperone cofactor D
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1107

 Score = 25.0 bits (52), Expect = 8.5
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 7/96 (7%)
 Frame = +1

Query: 166  QILNEI-IDALESPD------YASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHG 324
            ++LNE+ I  LE P+      Y   +  A     +  +K  +     V Q+E ++ K   
Sbjct: 879  EVLNELNISLLEIPNLRLQAFYGITVFTADGFGSDLAVKCFEFYLSYVYQLE-DSFKK-- 935

Query: 325  FNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHY 432
             +NSR G     QL  D+ S + E+AR +  I   +
Sbjct: 936  -SNSRYGKRDLLQLYIDILSSEDEIARFYFPIMKSF 970


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,367,728
Number of Sequences: 5004
Number of extensions: 46741
Number of successful extensions: 109
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 106
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 109
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 262236260
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -