SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A18
         (487 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC23A1.08c |rpl3401|rpl34, rpl34-1|60S ribosomal protein L34|S...   125   3e-30
SPCC1322.15 |rpl3402|rpl34, rpl34-2|60S ribosomal protein L34|Sc...   121   5e-29
SPBC902.02c |ctf18|chl12|DNA replication factor C complex subuni...    28   0.65 
SPBP35G2.08c |air1||zinc knuckle TRAMP complex subunit Air1|Schi...    27   2.0  
SPAC29B12.13 |||carbon-sulfur lyase |Schizosaccharomyces pombe|c...    26   2.6  
SPAC2E1P5.03 |||DNAJ domain protein Erj5|Schizosaccharomyces pom...    26   2.6  

>SPAC23A1.08c |rpl3401|rpl34, rpl34-1|60S ribosomal protein
           L34|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 112

 Score =  125 bits (302), Expect = 3e-30
 Identities = 60/102 (58%), Positives = 74/102 (72%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           M QR+T+RRRL+YNT+SN+ RI++TPG  + Y ++KK   IPRCG     L+GI   RP 
Sbjct: 1   MAQRVTYRRRLAYNTRSNRTRIIKTPGNNIRYLHIKKLGTIPRCGDTGVPLQGIPALRPR 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           E +RL + KKTV+R YGG L    VK RIVRAFLIEEQKIVK
Sbjct: 61  EFARLSHNKKTVQRAYGGCLSANAVKDRIVRAFLIEEQKIVK 102


>SPCC1322.15 |rpl3402|rpl34, rpl34-2|60S ribosomal protein
           L34|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 111

 Score =  121 bits (292), Expect = 5e-29
 Identities = 58/102 (56%), Positives = 73/102 (71%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           M QR+T+RRRL+YNT+SN+ RI++TPG  + Y ++KK   IPRCG     L+GI   RP 
Sbjct: 1   MAQRVTYRRRLAYNTRSNKTRIIKTPGNNIRYLHIKKLGTIPRCGDTGVPLQGIPALRPR 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           E +RL + +K V+R YGG L    VK RIVRAFLIEEQKIVK
Sbjct: 61  EFARLSHNQKKVQRAYGGCLSANAVKDRIVRAFLIEEQKIVK 102


>SPBC902.02c |ctf18|chl12|DNA replication factor C complex subunit
           Ctf18|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 960

 Score = 28.3 bits (60), Expect = 0.65
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = -2

Query: 303 SDNALLDTFMAEDTTINTFH 244
           SDNA +DT ++ED TIN  H
Sbjct: 83  SDNAAIDTDISEDETINQRH 102


>SPBP35G2.08c |air1||zinc knuckle TRAMP complex subunit
           Air1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 313

 Score = 26.6 bits (56), Expect = 2.0
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 52  RRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPR 159
           RR  + N KS+++R    PG  L  +   KPK   R
Sbjct: 244 RREQNRNQKSSKQRPFHKPGNSLASRLGSKPKSFKR 279


>SPAC29B12.13 |||carbon-sulfur lyase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 137

 Score = 26.2 bits (55), Expect = 2.6
 Identities = 12/30 (40%), Positives = 15/30 (50%)
 Frame = -3

Query: 404 LSPKIHFVAFFADLVLACCALRTFTIFCSS 315
           L   IH  A   +  L+CC   T  I+CSS
Sbjct: 9   LCKAIHLKAIIEEPKLSCCHCETCRIWCSS 38


>SPAC2E1P5.03 |||DNAJ domain protein Erj5|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 303

 Score = 26.2 bits (55), Expect = 2.6
 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%)
 Frame = +1

Query: 52  RRRLSYNTKSN-QRRIVRTPGGRLVY 126
           R+  SY T +   +RIV+ PGGR +Y
Sbjct: 161 RQHESYATSARGSKRIVQVPGGRRIY 186


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,636,721
Number of Sequences: 5004
Number of extensions: 33298
Number of successful extensions: 83
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 83
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 83
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 188065158
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -