SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A16
         (653 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC227.07c |pab1||protein phosphatase regulatory subunit Pab1|S...    27   2.4  
SPAC9E9.10c |cbh1|cbh|centromere binding protein |Schizosaccharo...    27   2.4  
SPCC757.11c |||membrane transporter|Schizosaccharomyces pombe|ch...    26   4.1  
SPAC1B9.03c ||SPAC6B12.01|RNA-binding protein|Schizosaccharomyce...    26   4.1  
SPCC1739.14 |npp106||nucleoporin Npp106|Schizosaccharomyces pomb...    26   5.5  
SPBC19F8.03c |||clathrin binding protein|Schizosaccharomyces pom...    25   7.2  
SPBC530.06c |||translation initiation factor eIF3 alpha subunit ...    25   9.5  

>SPAC227.07c |pab1||protein phosphatase regulatory subunit
           Pab1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 463

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 4/85 (4%)
 Frame = +2

Query: 320 HTDSHLITQEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTK----LASLYVPEKD 487
           HT  +L T +KGG++ +FE  +S          +Y  F  F+++      L SL + EK 
Sbjct: 39  HTGDYLATGDKGGRVVLFERNHSKK------GCEYKFFTEFQSHEPEFDYLKSLEIEEKI 92

Query: 488 YKINIYNFNGEKLGSLEYDDASVKL 562
            KI            L  +D ++KL
Sbjct: 93  NKIRWCKRTNRAHFLLSTNDKTIKL 117


>SPAC9E9.10c |cbh1|cbh|centromere binding protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 514

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +2

Query: 542 DDASVKLGDVMCLKFIEFPCDRPXSTSWLRSR 637
           DD SV+LGD+  ++  +FP        WL+ R
Sbjct: 61  DDGSVRLGDIKKIRAPKFPLLDNAVYEWLQQR 92


>SPCC757.11c |||membrane transporter|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 471

 Score = 26.2 bits (55), Expect = 4.1
 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 2/36 (5%)
 Frame = -2

Query: 322 VYKMKNRSLTNLYLLLNSICLEVVC--VNITVFRTG 221
           ++    R LT+  ++L   CL +VC  ++IT+  TG
Sbjct: 336 IFSYLTRYLTDRDIILLGCCLNIVCMVIHITIHYTG 371


>SPAC1B9.03c ||SPAC6B12.01|RNA-binding protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 389

 Score = 26.2 bits (55), Expect = 4.1
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = +2

Query: 380 TNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPEKDYKINI 502
           ++S  EEDA +E+D P   + E N   AS  +  K   I +
Sbjct: 249 SDSEIEEDATVEIDRPVPTKTEENLLSASQLLKPKQQAIKL 289


>SPCC1739.14 |npp106||nucleoporin Npp106|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 933

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 1/61 (1%)
 Frame = +2

Query: 410 IEVDYPGFCRFEANTKLASLYVPEKD-YKINIYNFNGEKLGSLEYDDASVKLGDVMCLKF 586
           + + Y G  R +   K  ++ + E D  KIN        L  LEY DA+V L  + C+  
Sbjct: 578 VAMAYYGLLRTKNYEKNENILIYEADDVKINFPQLIIAYLKHLEYVDAAVYLDYIACIPL 637

Query: 587 I 589
           +
Sbjct: 638 V 638


>SPBC19F8.03c |||clathrin binding protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 649

 Score = 25.4 bits (53), Expect = 7.2
 Identities = 12/47 (25%), Positives = 22/47 (46%)
 Frame = +2

Query: 167 PVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPI 307
           P+ S A    P G    +  S NG+ + ++     + QK+ V + P+
Sbjct: 566 PLPSPAHIMYPEGSPGFIQHSPNGFTHGHSASPVNIGQKLDVPERPM 612


>SPBC530.06c |||translation initiation factor eIF3 alpha subunit
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1173

 Score = 25.0 bits (52), Expect = 9.5
 Identities = 8/22 (36%), Positives = 15/22 (68%)
 Frame = -2

Query: 463  CEFCVGFESTKTRIIYFNYGIF 398
            CE  +GF+S++T + Y N  ++
Sbjct: 1014 CERFLGFDSSETSLAYMNLSLY 1035


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,472,707
Number of Sequences: 5004
Number of extensions: 48924
Number of successful extensions: 132
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 129
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 132
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 295793106
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -