SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A15
         (409 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC25G10.06 |rps2801|rps28-1|40S ribosomal protein S28|Schizosa...    74   7e-15
SPCC285.15c |rps2802|rps28-2, rps28|40S ribosomal protein S28|Sc...    74   7e-15
SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam...    27   0.85 
SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosacc...    27   1.1  
SPBC646.06c |agn2||glucan endo-1,3-alpha-glucosidase Agn2|Schizo...    26   2.6  
SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharom...    25   6.0  
SPAC1B3.16c |vht1||vitamin H transporter Vth1|Schizosaccharomyce...    24   7.9  
SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosa...    24   7.9  

>SPAC25G10.06 |rps2801|rps28-1|40S ribosomal protein
           S28|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 68

 Score = 74.1 bits (174), Expect = 7e-15
 Identities = 35/49 (71%), Positives = 42/49 (85%)
 Frame = +2

Query: 80  PNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDIL 226
           P  LA+V+KVLGRTGS+G  TQV+VEF+ +TSR IIRNVKGPVR+ DIL
Sbjct: 7   PVKLAKVIKVLGRTGSRGGVTQVRVEFMDDTSRSIIRNVKGPVREDDIL 55


>SPCC285.15c |rps2802|rps28-2, rps28|40S ribosomal protein
           S28|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 68

 Score = 74.1 bits (174), Expect = 7e-15
 Identities = 35/49 (71%), Positives = 42/49 (85%)
 Frame = +2

Query: 80  PNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDIL 226
           P  LA+V+KVLGRTGS+G  TQV+VEF+ +TSR IIRNVKGPVR+ DIL
Sbjct: 7   PVKLAKVIKVLGRTGSRGGVTQVRVEFMDDTSRSIIRNVKGPVREDDIL 55


>SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein
           Mam3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1082

 Score = 27.5 bits (58), Expect = 0.85
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +3

Query: 153 SSSLGRPAVRSSET*KDPSVTETSSLFLNLNVKL 254
           ++S+  PAV SSET    S+T T S + + +V +
Sbjct: 203 TTSVNSPAVSSSETLTSVSITSTESAYTSSSVDI 236


>SPCC10H11.01 |prp11||ATP-dependent RNA helicase
           Prp11|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1014

 Score = 27.1 bits (57), Expect = 1.1
 Identities = 20/48 (41%), Positives = 24/48 (50%)
 Frame = +2

Query: 20  ALVARVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFI 163
           ++VAR L   S  L    D PN +   V  +GRTG  G  T V V FI
Sbjct: 726 SVVARGLDVKSLQLVVNYDCPNHMEDYVHRVGRTGRAGH-TGVAVTFI 772


>SPBC646.06c |agn2||glucan endo-1,3-alpha-glucosidase
           Agn2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 433

 Score = 25.8 bits (54), Expect = 2.6
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = +1

Query: 97  CRESAWPYWFSGPVYSSEGRVHWGDQPSDHQK 192
           C+ + WPY+ S P   +E  V+  +  + ++K
Sbjct: 172 CKWNCWPYYTSSPTSDAEDLVYIQNSKATNKK 203


>SPCC777.15 |||tRNA dihydrouridine synthase Dus4
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 326

 Score = 24.6 bits (51), Expect = 6.0
 Identities = 9/38 (23%), Positives = 22/38 (57%)
 Frame = +2

Query: 65  AKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSR 178
           A +D+P  + ++V+ +  T  +  CT+VK+    + ++
Sbjct: 121 ALLDEPEKVHKLVRAVKSTLGESFCTEVKIRIAKDLNK 158


>SPAC1B3.16c |vht1||vitamin H transporter Vth1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 568

 Score = 24.2 bits (50), Expect = 7.9
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -2

Query: 135 WP*EPVRPSTFTTRARTLGLSILACNIE 52
           WP +P    +       +G+SI+AC IE
Sbjct: 498 WPGDPTFRKSNDVCIALIGVSIIACGIE 525


>SPAC23C4.19 |spt5||transcription elongation factor
           Spt5|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 990

 Score = 24.2 bits (50), Expect = 7.9
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = -1

Query: 214 VTDGSFHVSDDLTAGLPNELDLHLSTLAL 128
           +T+G     D+++   PN  DL LS+LAL
Sbjct: 435 ITEGVNPTLDEVSKFNPNNEDLDLSSLAL 463


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,631,782
Number of Sequences: 5004
Number of extensions: 28686
Number of successful extensions: 68
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 68
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 68
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 140222766
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -