SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A11
         (457 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC15E1.03 |rpl36a||60S ribosomal protein L36/L42|Schizosacchar...    79   2e-16
SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce...    28   0.59 
SPBC1709.11c |png2||ING family homolog Png2|Schizosaccharomyces ...    25   4.2  
SPAP8A3.14c |||mitochondrial inner membrane protein |Schizosacch...    25   5.5  
SPCC4B3.02c |||Golgi transport protein Got1 |Schizosaccharomyces...    25   7.3  
SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|...    25   7.3  
SPBC28F2.11 |||INO80 complex subunit |Schizosaccharomyces pombe|...    24   9.6  
SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr 1|||M...    24   9.6  

>SPAC15E1.03 |rpl36a||60S ribosomal protein
           L36/L42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 106

 Score = 79.4 bits (187), Expect = 2e-16
 Identities = 33/57 (57%), Positives = 41/57 (71%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           +GGQ+KP+F         +VLRLEC  CK ++Q+ LKRCKHFELGG+KK KG  IQF
Sbjct: 50  FGGQTKPVFHKKAKVTKKVVLRLECVSCKYKNQLVLKRCKHFELGGEKKTKGAAIQF 106



 Score = 27.9 bits (59), Expect = 0.78
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%)
 Frame = +3

Query: 111 MVNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVN+PK R+TY              +QYKK  +   AQG
Sbjct: 1   MVNIPKTRKTYCPGKNCRKHTVHRVTQYKKGPDSKLAQG 39



 Score = 27.5 bits (58), Expect = 1.0
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
 Frame = +1

Query: 157 NATKYTRYHST--KSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           N  K+T +  T  K      L + +RRYDRKQ G     +    K+ K
Sbjct: 16  NCRKHTVHRVTQYKKGPDSKLAQGKRRYDRKQSGFGGQTKPVFHKKAK 63


>SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1347

 Score = 28.3 bits (60), Expect = 0.59
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = -1

Query: 220 PWAACLSLDFLYCDTLCTLWHL 155
           P A  + L +LY DTL + WHL
Sbjct: 679 PLAVAILLHYLYTDTLLSPWHL 700


>SPBC1709.11c |png2||ING family homolog Png2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 305

 Score = 25.4 bits (53), Expect = 4.2
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = +1

Query: 178 YHSTKSPRKGTLPRXRRRYDRKQQGLRWSVQ 270
           YHST +P+     R  RR+   Q   ++S Q
Sbjct: 132 YHSTVTPQTSERRRETRRHQNNQHSQQYSSQ 162


>SPAP8A3.14c |||mitochondrial inner membrane protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 677

 Score = 25.0 bits (52), Expect = 5.5
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = +2

Query: 65  YLFLTFVDIVPNELKN 112
           +LF TFVD +P+ LKN
Sbjct: 462 FLFNTFVDQIPSYLKN 477


>SPCC4B3.02c |||Golgi transport protein Got1 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 129

 Score = 24.6 bits (51), Expect = 7.3
 Identities = 10/33 (30%), Positives = 18/33 (54%)
 Frame = -1

Query: 202 SLDFLYCDTLCTLWHLHFLQYVLRCFGTFTIFE 104
           S+ F +   L TL+H   + + + C G F +F+
Sbjct: 67  SISF-FSGLLLTLFHFPIIGFFVECLGFFNLFK 98


>SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 767

 Score = 24.6 bits (51), Expect = 7.3
 Identities = 16/64 (25%), Positives = 28/64 (43%)
 Frame = -1

Query: 271 FGLTTVXPAVYDHNVFXPWAACLSLDFLYCDTLCTLWHLHFLQYVLRCFGTFTIFEFVRH 92
           + + T+    + H+VF      L  + LY  T   L+    ++YV  C  + T   F + 
Sbjct: 152 YDIYTLCLVSWHHHVFSHIRDSLLQNLLYMFTKKRLYEPTDMKYVEVCVDSITSLSFDKT 211

Query: 91  DINK 80
           D+ K
Sbjct: 212 DMTK 215


>SPBC28F2.11 |||INO80 complex subunit |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 310

 Score = 24.2 bits (50), Expect = 9.6
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +3

Query: 258 VVSPNPSSKRRQKPLRKLCSVLS 326
           V SPNP S +R+K  R+  S+ S
Sbjct: 276 VSSPNPPSAKREKKKRRKSSMSS 298


>SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1115

 Score = 24.2 bits (50), Expect = 9.6
 Identities = 12/51 (23%), Positives = 24/51 (47%)
 Frame = +1

Query: 112 W*TYQNSAGRTAKNVNATKYTRYHSTKSPRKGTLPRXRRRYDRKQQGLRWS 264
           W  ++N   +++   + T YT++   + P    LP+ R  +    + LR S
Sbjct: 34  WTGHKNGQIKSSFGPSLTSYTQFIGHEGPVHQVLPQERGVFSLSSKSLRLS 84


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,779,856
Number of Sequences: 5004
Number of extensions: 33199
Number of successful extensions: 109
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 105
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 109
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 170285640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -