SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC17G9.07 |rps2402|rps24-2|40S ribosomal protein S24|Schizosac...   155   4e-39
SPAC17G6.06 |rps2401|rps24-1, rps24|40S ribosomal protein S24|Sc...   150   2e-37
SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|ch...    29   0.59 
SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|S...    28   1.4  
SPAC22A12.11 |dak1||dihydroxyacetone kinase Dak1|Schizosaccharom...    27   1.8  
SPCC1183.11 ||SPCC31H12.01|MS ion channel protein 1|Schizosaccha...    27   1.8  
SPCC188.11 |prp45|cwf13, snw1, SPCC584.08|transcriptional regula...    26   4.1  
SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual    26   5.5  

>SPBC17G9.07 |rps2402|rps24-2|40S ribosomal protein
           S24|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 134

 Score =  155 bits (377), Expect = 4e-39
 Identities = 79/122 (64%), Positives = 93/122 (76%), Gaps = 1/122 (0%)
 Frame = +1

Query: 88  MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 267
           MSE   TIRTRKFMTNRLL RKQMV D+LHPGK  +SK EIREKLA+MYK   + V  FG
Sbjct: 1   MSEAV-TIRTRKFMTNRLLQRKQMVVDILHPGKANLSKNEIREKLAQMYKTDSECVQAFG 59

Query: 268 FKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEK-KRPTRKQRKERKNRMKKVR 444
            +T+FGGG+STGFALIYD+ +  KKFEP +RL R G  E  ++  R+QRK+RKNR KKV 
Sbjct: 60  LRTHFGGGRSTGFALIYDSTESMKKFEPHYRLVRVGQAEPIQKVARQQRKQRKNRGKKVF 119

Query: 445 GT 450
           GT
Sbjct: 120 GT 121


>SPAC17G6.06 |rps2401|rps24-1, rps24|40S ribosomal protein
           S24|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 134

 Score =  150 bits (363), Expect = 2e-37
 Identities = 74/122 (60%), Positives = 91/122 (74%), Gaps = 1/122 (0%)
 Frame = +1

Query: 88  MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 267
           MSE   TIRTRKFMTNRLL RKQMV D+LHPGK  +SK ++REKL +MYK     V  FG
Sbjct: 1   MSEAV-TIRTRKFMTNRLLQRKQMVVDILHPGKANISKNDLREKLGQMYKTDASAVQAFG 59

Query: 268 FKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEK-KRPTRKQRKERKNRMKKVR 444
            +T++GGG++TGFALIYD ++  KKFEP +RL R G  E  ++  R+QRK+RKNR KKV 
Sbjct: 60  LRTHYGGGRTTGFALIYDDVEAMKKFEPHYRLVRVGHAEPIQKVARQQRKQRKNRGKKVF 119

Query: 445 GT 450
           GT
Sbjct: 120 GT 121


>SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 244

 Score = 29.1 bits (62), Expect = 0.59
 Identities = 29/79 (36%), Positives = 38/79 (48%)
 Frame = +3

Query: 153 ADGLRCFTSRKTNRQQDRDP*EARQNVQGYSRCSVRIRFQDKLRRWQVNWIRFDLRHTRS 332
           A G    +SR    Q+DRD  E R+N +   R S   R++D  RR      R D R+ R 
Sbjct: 14  AQGRNYESSRSRGDQRDRDYREYRRNYRD-ERSS--RRYEDSQRRDYSPARRRD-RYERH 69

Query: 333 GQEVRAQAQVSPPRPVREE 389
            + VR +   SP RPV  E
Sbjct: 70  RESVREE---SPRRPVEHE 85


>SPCC417.06c |ppk35|mug27|serine/threonine protein kinase
           Ppk35|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 624

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +1

Query: 340 KFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           K+ P  R    G + +KR  RK++ E+KN   K
Sbjct: 539 KYRPNARKPLVGRHREKRQLRKEKPEKKNNSTK 571


>SPAC22A12.11 |dak1||dihydroxyacetone kinase
           Dak1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 580

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +1

Query: 205 EIREKLAKMYKVTPDVVFVFGFKTNFGG 288
           +++E LAK YK+ P  +F   F T+  G
Sbjct: 286 KVKEALAKEYKINPVRIFAGPFTTSLNG 313


>SPCC1183.11 ||SPCC31H12.01|MS ion channel protein
           1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1011

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = -2

Query: 550 RYSTKTIXDFFVFYSLIPSIHITSWR 473
           RY+ K I  FF F+    S ++T WR
Sbjct: 287 RYAAKVIPYFFAFFVSFISNNVTKWR 312


>SPCC188.11 |prp45|cwf13, snw1, SPCC584.08|transcriptional regulator
           Prp45|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 557

 Score = 26.2 bits (55), Expect = 4.1
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +3

Query: 252 SVRIRFQDKLRRWQVNWIRFDLRHTRSGQEVRAQ-AQVSPPRPVREEEA 395
           S   R + +LRR +      DLR +R G E RA+ A+   PR V E  A
Sbjct: 385 SEAFRRRQELRRERRRQAEKDLRLSRMGAEKRAKLAEKDRPRDVAERVA 433


>SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1828

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = -3

Query: 120 ASANSRCSFTHFELFSII 67
           +S  SRCSFT FE+ SI+
Sbjct: 777 SSVISRCSFTDFEINSIL 794


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,667,242
Number of Sequences: 5004
Number of extensions: 55566
Number of successful extensions: 159
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 145
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 157
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 295793106
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -