SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A09
         (627 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC6B12.15 |cpc2|rkp1|RACK1 homologue Cpc2|Schizosaccharomyces ...   148   7e-37
SPBC354.03 |swd3||WD repeat protein Swd3|Schizosaccharomyces pom...    60   2e-10
SPAC18B11.10 |tup11||transcriptional corepressor Tup11|Schizosac...    58   1e-09
SPBC21B10.05c |pop3|wat1|WD repeat protein Pop3|Schizosaccharomy...    56   3e-09
SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein Pop2|Schizosacchar...    55   7e-09
SPBP22H7.07 |prp5|cwf1|WD repeat protein Prp5|Schizosaccharomyce...    54   2e-08
SPBC6B1.10 |prp17||splicing factor Prp17|Schizosaccharomyces pom...    53   3e-08
SPCC16A11.02 |utp13|SPCC63.16|U3 snoRNP-associated protein Utp13...    52   7e-08
SPCC5E4.03c |taf72||transcription factor TFIID complex subunit 5...    52   7e-08
SPAC630.14c |tup12||transcriptional corepressor Tup12 |Schizosac...    48   1e-06
SPCC18.05c |||notchless-like protein|Schizosaccharomyces pombe|c...    48   1e-06
SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein Pop1...    47   2e-06
SPAC227.12 |||U4/U6 x U5 tri-snRNP complex subunit Prp4 family|S...    47   2e-06
SPBPJ4664.04 |||coatomer alpha subunit |Schizosaccharomyces pomb...    46   3e-06
SPAC4D7.05 |sum1|tif34|translation initiation factor eIF3i|Schiz...    46   3e-06
SPAC29E6.01 |pof11|SPAC30.05, mug156|F-box protein Pof11|Schizos...    46   6e-06
SPBC15D4.14 |taf73||TATA-binding protein associated factor |Schi...    45   1e-05
SPBC16C6.13c |sec27||coatomer beta' subunit |Schizosaccharomyces...    42   7e-05
SPAC343.04c |gnr1||heterotrimeric G protein beta subunit Gnr1|Sc...    42   7e-05
SPBC32H8.07 |git5|gpb1|heterotrimeric G protein beta subunit Git...    42   7e-05
SPAC343.17c |||WD repeat protein, human WDR70 family|Schizosacch...    42   1e-04
SPBC713.04c |||U3 snoRNP-associated protein Utp1|Schizosaccharom...    42   1e-04
SPAC31A2.14 |||WD repeat protein, human WRDR48 family|Schizosacc...    41   1e-04
SPAC664.15 |||CCR4-Not complex subunit Caf4/Mdv1 |Schizosaccharo...    41   1e-04
SPCC126.01c ||SPCC576.18c|conserved fungal protein|Schizosacchar...    41   1e-04
SPBC1289.11 |spf38|cwf17|splicing factor Spf38|Schizosaccharomyc...    41   2e-04
SPBC1773.01 |||striatin homolog|Schizosaccharomyces pombe|chr 2|...    41   2e-04
SPBC577.09 |||ERCC-8 homolog |Schizosaccharomyces pombe|chr 2|||...    40   2e-04
SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schi...    40   2e-04
SPAC25H1.08c |||ribosome biogenesis protein Sqt1|Schizosaccharom...    40   2e-04
SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosac...    40   3e-04
SPAC57A10.05c |pof1||F-box protein Pof1|Schizosaccharomyces pomb...    39   7e-04
SPBC27B12.05 |||WD repeat protein|Schizosaccharomyces pombe|chr ...    38   0.001
SPBC215.15 |sec13||COPII-coated vesicle component Sec13|Schizosa...    37   0.002
SPBC14C8.17c |||SAGA complex subunit Spt8 |Schizosaccharomyces p...    37   0.002
SPBC428.19c |||U3 snoRNP protein Utp15 |Schizosaccharomyces pomb...    37   0.003
SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces p...    37   0.003
SPBC713.05 |||WD repeat protein, human MAPK organizer 1 |Schizos...    36   0.004
SPBC1711.16 |||WD repeat protein Pwp1 |Schizosaccharomyces pombe...    36   0.004
SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccha...    36   0.005
SPAC29A4.18 |prw1||Clr6 histone deacetylase complex subunit Prw1...    36   0.005
SPCC895.06 |||RNA polymerase II elongator complex subunit Elp2 |...    36   0.005
SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosacchar...    36   0.006
SPAC3H5.08c |||WD repeat protein Wdr44 family|Schizosaccharomyce...    35   0.008
SPBC16A3.05c |rae1||RNA export factor Rae1|Schizosaccharomyces p...    35   0.011
SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha...    34   0.015
SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch...    34   0.015
SPAC17D4.01 |pex7|SPAC1834.12|peroxin-7 |Schizosaccharomyces pom...    34   0.019
SPAC890.04c |||ribosome biogenesis protein Ytm1 |Schizosaccharom...    34   0.019
SPAC12G12.14c |pfs2||WD repeat protein Pfs2|Schizosaccharomyces ...    34   0.019
SPBC18H10.05 |||WD repeat protein Wdr44 family, WD repeat protei...    33   0.026
SPAC806.02c |||Par A family ATPase iron cluster assembly protein...    33   0.045
SPBC32F12.02 |rec14||recombination protein Rec14|Schizosaccharom...    32   0.059
SPAC26H5.03 |||WD repeat protein Cac2|Schizosaccharomyces pombe|...    32   0.059
SPAC9G1.05 |||actin cortical patch component Aip1 |Schizosacchar...    32   0.059
SPBC3D6.12 |||U3 snoRNA associted protein Dip2 |Schizosaccharomy...    32   0.078
SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyc...    32   0.078
SPBC1198.12 |mfr1|SPBC660.02|fizzy-related protein Mfr1|Schizosa...    31   0.10 
SPAC144.13c |srw1|ste9|CDK inhibitor Srw1|Schizosaccharomyces po...    31   0.14 
SPAC23H3.08c |bub3||mitotic spindle checkpoint protein Bub3|Schi...    31   0.18 
SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces p...    31   0.18 
SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces po...    31   0.18 
SPBC1A4.07c |||U3 snoRNP-associated protein Sof1|Schizosaccharom...    31   0.18 
SPBC18H10.06c |swd2|swd2.1|COMPASS complex subunit Swd2|Schizosa...    31   0.18 
SPAC959.03c |||U3 snoRNP-associated protein Utp7|Schizosaccharom...    31   0.18 
SPAC824.04 |||WD repeat protein|Schizosaccharomyces pombe|chr 1|...    30   0.24 
SPAC2E1P5.05 |||U3 snoRNP-associated protein Rrp9 |Schizosacchar...    30   0.24 
SPAC23H3.05c |swd1||COMPASS complex subunit Swd1|Schizosaccharom...    30   0.24 
SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|c...    30   0.31 
SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo...    28   0.96 
SPAC227.07c |pab1||protein phosphatase regulatory subunit Pab1|S...    28   1.3  
SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe...    28   1.3  
SPBC4F6.13c |||WD repeat/BOP1NT protein|Schizosaccharomyces pomb...    28   1.3  
SPBC21.05c |ral2||Ras guanyl-nucleotide exchange factor Ral2 |Sc...    27   1.7  
SPCC18.13 |||tRNA |Schizosaccharomyces pombe|chr 3|||Manual            26   3.9  
SPCC1827.08c |pof7|SPCC70.11c|F-box protein Pof7|Schizosaccharom...    26   3.9  
SPBC17D11.08 |||WD repeat protein, human WDR68 family|Schizosacc...    26   3.9  
SPBC119.07 |ppk19||serine/threonine protein kinase Ppk19|Schizos...    26   5.1  
SPCC16C4.08c |skb15||Shk1 kinase binding protein 15|Schizosaccha...    26   5.1  
SPAC12B10.07 |acp1||F-actin capping protein alpha subunit|Schizo...    25   6.8  
SPAC25H1.06 |||histone acetyltransferase complex subunit |Schizo...    25   6.8  
SPBC2A9.03 |||conserved protein |Schizosaccharomyces pombe|chr 2...    25   6.8  
SPCC63.06 |||human WDR89 family WD repeat protein|Schizosaccharo...    25   6.8  
SPCC613.12c |raf1|dos1, cmc1, clr8|Rik1-associated factor Raf1|S...    25   6.8  
SPAC7D4.09c |||steroid dehydrogenase |Schizosaccharomyces pombe|...    25   9.0  
SPBP35G2.03c |sgo1||shugoshin Sgo1|Schizosaccharomyces pombe|chr...    25   9.0  
SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomy...    25   9.0  

>SPAC6B12.15 |cpc2|rkp1|RACK1 homologue Cpc2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 314

 Score =  148 bits (358), Expect = 7e-37
 Identities = 63/105 (60%), Positives = 80/105 (76%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M E L LR TL GH+GWVT ++T P+ PD++LS SRDK++I+W L RD+ NYG+ Q+RL 
Sbjct: 1   MPEQLVLRATLEGHSGWVTSLSTAPENPDILLSGSRDKSIILWNLVRDDVNYGVAQRRLT 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GHSHF+SD  LS D +YALS SWDKT+RLWDL  G+ T +F  HT
Sbjct: 61  GHSHFVSDCALSFDSHYALSASWDKTIRLWDLEKGECTHQFVGHT 105



 Score = 52.4 bits (120), Expect = 5e-08
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 2/82 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMI--LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           GH+ WV+ +  +P  PD +  +S+  DK + VW L      + +     YGH+ ++S V 
Sbjct: 146 GHSDWVSCVRFSPN-PDNLTFVSAGWDKAVKVWDL----ETFSLRTSH-YGHTGYVSAVT 199

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
           +S DG+   SG  D TL LWDL
Sbjct: 200 ISPDGSLCASGGRDGTLMLWDL 221



 Score = 45.2 bits (102), Expect = 8e-06
 Identities = 26/82 (31%), Positives = 45/82 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +V+  A +       LS+S DKT+ +W L + E  +     +  GH+  +  V 
Sbjct: 59  LTGHSHFVSDCALSFD-SHYALSASWDKTIRLWDLEKGECTH-----QFVGHTSDVLSVS 112

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
           +S D    +SGS DKT+++W++
Sbjct: 113 ISPDNRQVVSGSRDKTIKIWNI 134



 Score = 42.7 bits (96), Expect = 4e-05
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 2/95 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  ++ +P    ++ S SRDKT+ +W +  +   Y I      GHS ++S V  S
Sbjct: 103 GHTSDVLSVSISPDNRQVV-SGSRDKTIKIWNIIGN-CKYTITDG---GHSDWVSCVRFS 157

Query: 257 S--DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              D    +S  WDK +++WDL           HT
Sbjct: 158 PNPDNLTFVSAGWDKAVKVWDLETFSLRTSHYGHT 192



 Score = 37.9 bits (84), Expect = 0.001
 Identities = 24/90 (26%), Positives = 42/90 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET  LR +  GH G+V+ +  +P    +  S  RD TL++W L    + Y +  K     
Sbjct: 180 ETFSLRTSHYGHTGYVSAVTISPD-GSLCASGGRDGTLMLWDLNESTHLYSLEAKANI-- 236

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
                + ++ S   Y L  +   ++R++DL
Sbjct: 237 -----NALVFSPNRYWLCAATGSSIRIFDL 261


>SPBC354.03 |swd3||WD repeat protein Swd3|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 380

 Score = 60.5 bits (140), Expect = 2e-10
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 2/105 (1%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQI--ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T +L  TL GH   ++Q+  AT  KY   + S+S DKT+ +W     E    +  + L G
Sbjct: 85  TFRLECTLFGHYRGISQVKWATGSKY---LASASDDKTIRIWDF---EKRCSV--RCLKG 136

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H++++S +  +  G   +SGSWD+T+R+W+L  G   R    H++
Sbjct: 137 HTNYVSSIDFNPLGTLLVSGSWDETVRIWNLQDGTCLRMLPAHSE 181



 Score = 50.0 bits (114), Expect = 3e-07
 Identities = 29/86 (33%), Positives = 48/86 (55%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH  +V+ I  NP    +++S S D+T+ +W L +D    G   + L  HS  I  V 
Sbjct: 134 LKGHTNYVSSIDFNP-LGTLLVSGSWDETVRIWNL-QD----GTCLRMLPAHSEPIISVS 187

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
           +S+DG    + S+D   R+WD+ +G+
Sbjct: 188 ISADGTLCATASYDGMARIWDVLSGQ 213



 Score = 25.0 bits (52), Expect = 9.0
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           L+GH   ++ V +S +  +  + S D T+++W
Sbjct: 50  LFGHEKSVTCVSVSPNKRWIATSSSDGTIKIW 81


>SPAC18B11.10 |tup11||transcriptional corepressor
           Tup11|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 614

 Score = 58.0 bits (134), Expect = 1e-09
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 7/101 (6%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL--TRDENNYGI-PQ---KRLY-GHS 229
           L GH   V  IA +P    ++LS S DKT+ VW+L  TR      I P+   K  Y GH+
Sbjct: 480 LEGHKESVYSIAFSPD-SSILLSGSLDKTIKVWELQATRSVGLSAIKPEGICKATYTGHT 538

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            F+  V +S D  + LSGS D++++ WDL  G++    + H
Sbjct: 539 DFVLSVAVSPDSRWGLSGSKDRSMQFWDLQTGQSYLTCQGH 579



 Score = 46.8 bits (106), Expect = 3e-06
 Identities = 29/83 (34%), Positives = 44/83 (53%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           NG VT IA +P     I   S D+ + VW ++      G   +RL GH   +  +  S D
Sbjct: 444 NG-VTAIAISPN-DQFIAVGSLDQIIRVWSVS------GTLVERLEGHKESVYSIAFSPD 495

Query: 263 GNYALSGSWDKTLRLWDLAAGKT 331
            +  LSGS DKT+++W+L A ++
Sbjct: 496 SSILLSGSLDKTIKVWELQATRS 518



 Score = 41.9 bits (94), Expect = 7e-05
 Identities = 24/86 (27%), Positives = 43/86 (50%)
 Frame = +2

Query: 89  WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGN 268
           +V  IA +P     +++ + D+ + +W L+  +  Y        GH   I  +  S +G 
Sbjct: 362 YVRTIAFSPD-GKYLVTGTEDRQIKLWDLSTQKVRYVFS-----GHEQDIYSLDFSHNGR 415

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFE 346
           + +SGS D+T RLWD+  G+   + E
Sbjct: 416 FIVSGSGDRTARLWDVETGQCILKLE 441



 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 40/85 (47%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           + T  GH  +V  +A +P      LS S+D+++  W L   ++ Y   Q    GH + + 
Sbjct: 531 KATYTGHTDFVLSVAVSPD-SRWGLSGSKDRSMQFWDLQTGQS-YLTCQ----GHKNSVI 584

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDL 316
            V  S DG    SGS D   R+W +
Sbjct: 585 SVCFSPDGRQFASGSGDLRARIWSI 609



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 13/40 (32%), Positives = 23/40 (57%)
 Frame = +2

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++  +  S DG Y ++G+ D+ ++LWDL+  K    F  H
Sbjct: 362 YVRTIAFSPDGKYLVTGTEDRQIKLWDLSTQKVRYVFSGH 401


>SPBC21B10.05c |pop3|wat1|WD repeat protein Pop3|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 314

 Score = 56.4 bits (130), Expect = 3e-09
 Identities = 27/95 (28%), Positives = 51/95 (53%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           + H  ++T+   +P    +   S+ D T+ +W     E+   + ++RL GH  ++ D   
Sbjct: 212 QAHQRYITRCVLSPDVKHLATCSA-DATVNIWST---EDMSFMLERRLQGHQRWVWDCAF 267

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           S+D  Y ++ S D   RLW+L++G+T R++  H K
Sbjct: 268 SADSTYLVTASSDHVARLWELSSGETIRQYSGHHK 302



 Score = 34.7 bits (76), Expect = 0.011
 Identities = 13/54 (24%), Positives = 28/54 (51%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +P     GH++ ++ +    DG +  + S D T+++WD+ A    R ++  + V
Sbjct: 74  MPLMTFEGHTNNVTAIAFHCDGKWLATSSEDGTVKVWDMRAPSVQRNYDHKSPV 127



 Score = 31.1 bits (67), Expect = 0.14
 Identities = 24/89 (26%), Positives = 37/89 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   VT IA +      + +SS D T+ VW +           +R Y H   ++D+
Sbjct: 78  TFEGHTNNVTAIAFHCD-GKWLATSSEDGTVKVWDMRAPS------VQRNYDHKSPVNDL 130

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           ++  +    LS      +R WDL     T
Sbjct: 131 LIHPNQGELLSCDQSGRVRAWDLGENSCT 159



 Score = 29.1 bits (62), Expect = 0.55
 Identities = 14/62 (22%), Positives = 29/62 (46%), Gaps = 1/62 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGI-PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           M+++ +      VW++   +    + P  +   H  +I+  VLS D  +  + S D T+ 
Sbjct: 181 MLIAGNNKGNCYVWRMLNHQGASLLQPVVKFQAHQRYITRCVLSPDVKHLATCSADATVN 240

Query: 305 LW 310
           +W
Sbjct: 241 IW 242


>SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein
           Pop2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 703

 Score = 55.2 bits (127), Expect = 7e-09
 Identities = 33/95 (34%), Positives = 50/95 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  I+    Y D+++S S D ++ +W+++  E  Y      L GHS  I  V
Sbjct: 502 TLIGHTDSVRTISG---YGDILVSGSYDSSIRIWRVSTGECLY-----HLRGHSLRIYSV 553

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +   + N  +SGS DK++R+WDL+ G      E H
Sbjct: 554 LYEPERNICISGSMDKSIRVWDLSTGTCKYVLEGH 588



 Score = 47.6 bits (108), Expect = 1e-06
 Identities = 30/86 (34%), Positives = 47/86 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+  +  +   P+  ++ +S S DK++ VW L+     Y      L GH  F++  +
Sbjct: 543 LRGHSLRIYSVLYEPER-NICISGSMDKSIRVWDLSTGTCKYV-----LEGHDAFVT--L 594

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
           L+   N  +SGS D T+R+WDL  GK
Sbjct: 595 LNVFQNRLISGSADSTIRIWDLNTGK 620



 Score = 39.1 bits (87), Expect = 5e-04
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 13/88 (14%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQK-----RLYGHSHFISDVV--------LSSDGNY 271
           I+S SRD TL VWKL ++ +   +P       R   + +F+  ++        +S  G+ 
Sbjct: 460 IVSGSRDHTLRVWKLPKNTDPPYLPDNTNSIDRWEKNPYFVHTLIGHTDSVRTISGYGDI 519

Query: 272 ALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +SGS+D ++R+W ++ G+       H+
Sbjct: 520 LVSGSYDSSIRIWRVSTGECLYHLRGHS 547



 Score = 37.9 bits (84), Expect = 0.001
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +2

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           G+ + RL GH   +  V +    N  +SGS DKT+R+W++   K T  F  H  +
Sbjct: 381 GVLEARLEGHKEGVWAVKIHE--NTLVSGSIDKTVRVWNIEKAKCTHIFRGHISI 433



 Score = 28.3 bits (60), Expect = 0.96
 Identities = 30/108 (27%), Positives = 45/108 (41%), Gaps = 9/108 (8%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNY---G----IPQKRL 217
           L   L GH   V  +     + + ++S S DKT+ VW + + +  +   G    I    +
Sbjct: 383 LEARLEGHKEGVWAVKI---HENTLVSGSIDKTVRVWNIEKAKCTHIFRGHISIIRCLEI 439

Query: 218 YGHSHFISDVV--LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S  I   V  +  D  Y +SGS D TLR+W L          D+T
Sbjct: 440 LVPSRLIRHGVEIVEPDQPYIVSGSRDHTLRVWKLPKNTDPPYLPDNT 487


>SPBP22H7.07 |prp5|cwf1|WD repeat protein Prp5|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 473

 Score = 53.6 bits (123), Expect = 2e-08
 Identities = 33/104 (31%), Positives = 50/104 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K+     GH   V  +  +P   D+++++ RD    VW + R   N  +    L GH
Sbjct: 235 ETNKVIRHYHGHLSGVYALKLHPTL-DVLVTAGRDAVARVWDM-RTRQNVHV----LSGH 288

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              ++ + +       ++GS D T+RLWDLAAGKT      H K
Sbjct: 289 KSTVASLAVQEFDPQVVTGSMDSTIRLWDLAAGKTLTTLTHHKK 332



 Score = 44.0 bits (99), Expect = 2e-05
 Identities = 26/98 (26%), Positives = 41/98 (41%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L   + GH GWV  +   P       + + D+T+ +W L       G+ +  L GH   +
Sbjct: 155 LMRVISGHLGWVRCVDVEPGN-QWFCTGAGDRTIKIWDLAS-----GVLKLTLTGHIATV 208

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + +S    Y  S   DK ++ WDL   K  R +  H
Sbjct: 209 RGLAVSPRHPYLFSCGEDKMVKCWDLETNKVIRHYHGH 246


>SPBC6B1.10 |prp17||splicing factor Prp17|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 558

 Score = 53.2 bits (122), Expect = 3e-08
 Identities = 29/92 (31%), Positives = 46/92 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH   ++ +   P    ++LS S D  + +W++  D +      +   GH+  I D+
Sbjct: 261 TWKGHTKGISCLRFFPISGHLLLSGSMDNQIKIWEVYHDRSLL----RTFQGHARPIRDL 316

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
             S DG   LS S+DKT++LWD   GK    F
Sbjct: 317 SFSQDGRSFLSTSFDKTIKLWDTELGKCLNCF 348


>SPCC16A11.02 |utp13|SPCC63.16|U3 snoRNP-associated protein Utp13
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 777

 Score = 52.0 bits (119), Expect = 7e-08
 Identities = 30/101 (29%), Positives = 47/101 (46%), Gaps = 7/101 (6%)
 Frame = +2

Query: 77  GHNGWVTQIATNPK----YPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY---GHSHF 235
           GH   VT +A  P     YP  + SSS+D+TL  + L    N      + ++    H   
Sbjct: 408 GHTASVTAVALGPLDVNGYPTFLASSSQDRTLKRFNLGSQLNKSDFSNRAVWTIKAHDRD 467

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           ++ + +S DG    S S DKT++LWD + G+       H +
Sbjct: 468 VNAIQVSKDGRIIASASQDKTIKLWDSSTGEVVGVLRGHRR 508



 Score = 46.8 bits (106), Expect = 3e-06
 Identities = 27/103 (26%), Positives = 51/103 (49%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S T ++ G LRGH   V   + NP +   + S S D+T+ +W +   +       + L G
Sbjct: 494 SSTGEVVGVLRGHRRGVWACSFNP-FSRQLASGSGDRTIRIWNVDTQQC-----VQTLEG 547

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           H+  I  ++  S G   +S + D  +++W L++G+     ++H
Sbjct: 548 HTGAILKLIYISQGTQVVSAAADGLVKVWSLSSGECVATLDNH 590



 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 1/91 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLI-VWKLTRDENNYGIPQKRLYGHSHFISD 244
           + RGH G ++ +         +L+S  D + + +W L    +          GHS  I  
Sbjct: 140 SFRGHGGVISALCFGKHQNTWVLASGADDSRVRLWDLNSSRS-----MAVFEGHSSVIRG 194

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           +     G++ LSGS DKT+++W++      R
Sbjct: 195 LTFEPTGSFLLSGSRDKTVQVWNIKKRSAVR 225



 Score = 38.7 bits (86), Expect = 7e-04
 Identities = 27/96 (28%), Positives = 47/96 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T++ H+  V  I  + K   +I S+S+DKT+ +W  +  E   G+    L GH   +   
Sbjct: 460 TIKAHDRDVNAIQVS-KDGRIIASASQDKTIKLWDSSTGEV-VGV----LRGHRRGVWAC 513

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +       SGS D+T+R+W++   +  +  E HT
Sbjct: 514 SFNPFSRQLASGSGDRTIRIWNVDTQQCVQTLEGHT 549



 Score = 31.1 bits (67), Expect = 0.14
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 2/49 (4%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGN--YALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           GH   IS +      N     SG+ D  +RLWDL + ++   FE H+ V
Sbjct: 143 GHGGVISALCFGKHQNTWVLASGADDSRVRLWDLNSSRSMAVFEGHSSV 191



 Score = 31.1 bits (67), Expect = 0.14
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH+  +  +  S DG +  +G+ D T+RLW+L
Sbjct: 360 LEGHTDIVLTLDSSEDGVWLATGAKDNTVRLWNL 393



 Score = 25.4 bits (53), Expect = 6.8
 Identities = 18/82 (21%), Positives = 31/82 (37%), Gaps = 4/82 (4%)
 Frame = +2

Query: 119 YPDMILSSSRDKTLIVWKLTRDENNYGIPQ----KRLYGHSHFISDVVLSSDGNYALSGS 286
           Y   +  +S  K LI    +R    Y IP     K +  H   +  + +        +G 
Sbjct: 63  YVTALAITSDSKKLIAAFRSRLLTIYEIPSGRRIKSMKAHETPVITMTIDPTNTLLATGG 122

Query: 287 WDKTLRLWDLAAGKTTRRFEDH 352
            +  +++WD+A    T  F  H
Sbjct: 123 AEGLVKVWDIAGAYVTHSFRGH 144


>SPCC5E4.03c |taf72||transcription factor TFIID complex subunit 5
           Taf72|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 643

 Score = 52.0 bits (119), Expect = 7e-08
 Identities = 30/95 (31%), Positives = 46/95 (48%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH G V  +A  P +     ++S D+T  +W       ++  P +   GH   +  V  
Sbjct: 418 KGHTGPVWDVAFGP-FGHYFATASHDQTAQLWSC-----DHIYPLRVFAGHLSDVDCVTF 471

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             +  Y L+GS DKT RLWD+  G + R F  HT+
Sbjct: 472 HPNSAYVLTGSSDKTCRLWDVHRGHSVRVFNGHTQ 506



 Score = 37.9 bits (84), Expect = 0.001
 Identities = 23/92 (25%), Positives = 41/92 (44%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P     +L+ S DKT  +W + R     G   +   GH+  ++ V ++
Sbjct: 461 GHLSDVDCVTFHPNSA-YVLTGSSDKTCRLWDVHR-----GHSVRVFNGHTQPVTAVAIA 514

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            DG+   S   +  + LWD+  G+  +    H
Sbjct: 515 PDGHTMASADSEGLIHLWDIGTGRRIKTMRGH 546



 Score = 31.1 bits (67), Expect = 0.14
 Identities = 16/48 (33%), Positives = 21/48 (43%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           RL  HS  +     S D  Y LS S D + RLW +        ++ HT
Sbjct: 374 RLLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAYKGHT 421



 Score = 28.3 bits (60), Expect = 0.96
 Identities = 22/80 (27%), Positives = 34/80 (42%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   VT +A  P    M  S+  +  + +W +       G   K + GH   I  +  S
Sbjct: 503 GHTQPVTAVAIAPDGHTMA-SADSEGLIHLWDI-----GTGRRIKTMRGHRGNIYSLSFS 556

Query: 257 SDGNYALSGSWDKTLRLWDL 316
            +    +SG  D T+R WD+
Sbjct: 557 RESTVLVSGGSDCTVRAWDV 576


>SPAC630.14c |tup12||transcriptional corepressor Tup12
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 586

 Score = 48.0 bits (109), Expect = 1e-06
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 7/87 (8%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN-------NYGIPQKRLYGHS 229
           L GH   V  +A +P     ++S S D T+ +W+L    N         GI ++   GH 
Sbjct: 454 LHGHEESVYSVAFSPD-GKYLVSGSLDNTIKLWELQCVSNVAPSMYKEGGICKQTFTGHK 512

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
            FI  V +S DG + +SGS D+T++ W
Sbjct: 513 DFILSVTVSPDGKWIISGSKDRTIQFW 539



 Score = 46.4 bits (105), Expect = 3e-06
 Identities = 25/75 (33%), Positives = 39/75 (52%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           VT +  +P     I + S DK + +W       + G   ++L+GH   +  V  S DG Y
Sbjct: 420 VTTVMFSPD-GQFIAAGSLDKVIRIW------TSSGTLVEQLHGHEESVYSVAFSPDGKY 472

Query: 272 ALSGSWDKTLRLWDL 316
            +SGS D T++LW+L
Sbjct: 473 LVSGSLDNTIKLWEL 487



 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 4/49 (8%)
 Frame = +2

Query: 194 YGIPQKRLY----GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           + I QKR+Y    GH   I  +  S DG   +SGS D+T+ LWD+ AG+
Sbjct: 361 WDIAQKRVYRLLTGHEQEIYSLDFSKDGKTLVSGSGDRTVCLWDVEAGE 409



 Score = 39.9 bits (89), Expect = 3e-04
 Identities = 22/81 (27%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH  ++  +  +P     I+S S+D+T+  W      +     Q  L GH++ +  V
Sbjct: 507 TFTGHKDFILSVTVSPD-GKWIISGSKDRTIQFWSPDSPHS-----QLTLQGHNNSVISV 560

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +S +G+   +GS D   R+W
Sbjct: 561 AVSPNGHCFATGSGDLRARIW 581



 Score = 37.1 bits (82), Expect = 0.002
 Identities = 20/74 (27%), Positives = 37/74 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S S D+T+ +W +   E      QK +      ++ V+ S DG +  +GS DK +R+W
Sbjct: 391 LVSGSGDRTVCLWDVEAGE------QKLILHTDDGVTTVMFSPDGQFIAAGSLDKVIRIW 444

Query: 311 DLAAGKTTRRFEDH 352
             ++G    +   H
Sbjct: 445 -TSSGTLVEQLHGH 457



 Score = 34.3 bits (75), Expect = 0.015
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++  V  S DG Y  +G  D+ +R+WD+A  +  R    H
Sbjct: 336 YVRSVAFSPDGKYLATGVEDQQIRIWDIAQKRVYRLLTGH 375


>SPCC18.05c |||notchless-like protein|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 502

 Score = 48.0 bits (109), Expect = 1e-06
 Identities = 31/88 (35%), Positives = 44/88 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K   TLRGH   V Q A +     +++SSS+D TL VW +   +  + +P     GH
Sbjct: 419 KTGKFLATLRGHVAAVYQCAWSTD-SRLLVSSSQDTTLKVWDVRSKKMKFDLP-----GH 472

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLW 310
              +  V  S DG    SG  DK +R+W
Sbjct: 473 EDQVFAVDWSPDGQRVASGGADKAVRIW 500



 Score = 43.2 bits (97), Expect = 3e-05
 Identities = 22/86 (25%), Positives = 40/86 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           ++ GH+G +     +P     +++ S D T  +W           P   + GH++++S V
Sbjct: 129 SMNGHDGTIISAQFSPSTSSRLVTGSGDFTARLWDCDTQT-----PIATMKGHTNWVSCV 183

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAG 325
             + D +   +GS D T+R WD   G
Sbjct: 184 AWAPDASIIATGSMDNTIRFWDPKKG 209



 Score = 42.7 bits (96), Expect = 4e-05
 Identities = 22/76 (28%), Positives = 36/76 (47%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + ++S+S D  LI+W    D      P  +++GH   ++    S DG    + S+D ++R
Sbjct: 359 ERLVSASDDLQLILW----DPQKSTKPITKMHGHQKVVNHASFSPDGRCIATASFDSSVR 414

Query: 305 LWDLAAGKTTRRFEDH 352
           LWD   GK       H
Sbjct: 415 LWDGKTGKFLATLRGH 430



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 23/77 (29%), Positives = 37/77 (48%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           P ++ S S+D T+ +W +      +      L GH+  I+ V      N+  S S+DKT+
Sbjct: 239 PYLLASGSKDNTVRIWNVKLRTLLF-----TLSGHTAPITCVRWGGQ-NWIYSSSYDKTI 292

Query: 302 RLWDLAAGKTTRRFEDH 352
           R+WD   GK     + H
Sbjct: 293 RIWDAKDGKCLHILKGH 309



 Score = 30.3 bits (65), Expect = 0.24
 Identities = 22/86 (25%), Positives = 38/86 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V   + +P     I ++S D ++ +W     +   G     L GH   +    
Sbjct: 385 MHGHQKVVNHASFSPD-GRCIATASFDSSVRLW-----DGKTGKFLATLRGHVAAVYQCA 438

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
            S+D    +S S D TL++WD+ + K
Sbjct: 439 WSTDSRLLVSSSQDTTLKVWDVRSKK 464


>SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein
           Pop1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 775

 Score = 47.2 bits (107), Expect = 2e-06
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH   V ++A      D+I+S+S D TL VWK +      G+    L GH   +  V
Sbjct: 572 TLRGHTDSVREVAC---LGDLIVSASYDGTLRVWKAST-----GVCLHVLRGHVGRVYSV 623

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            ++      +S   D  +R+W+L +G+  +    H+ +
Sbjct: 624 TINPSRQQCISAGTDAKIRIWNLESGELLQTLHGHSNL 661



 Score = 45.2 bits (102), Expect = 8e-06
 Identities = 28/85 (32%), Positives = 41/85 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH G V  +  NP     I S+  D  + +W L   E       + L+GHS+ +S V 
Sbjct: 613 LRGHVGRVYSVTINPSRQQCI-SAGTDAKIRIWNLESGEL-----LQTLHGHSNLVSQVT 666

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAG 325
            + +   + S   D +LR+WDL  G
Sbjct: 667 FNQNILVSASAPPDTSLRVWDLNTG 691



 Score = 34.3 bits (75), Expect = 0.015
 Identities = 31/97 (31%), Positives = 45/97 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E+ +L  TL GH+  V+Q+  N     +  S+  D +L VW L        +  K   GH
Sbjct: 647 ESGELLQTLHGHSNLVSQVTFNQNIL-VSASAPPDTSLRVWDLNTGSCRDIL--KCPLGH 703

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
             F        D +  +SGS   TL+LWD+ +GK  R
Sbjct: 704 IFF------QHDESKVVSGS-HSTLQLWDIRSGKLVR 733



 Score = 33.5 bits (73), Expect = 0.026
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           G+  ++GS D+T+R+WDL  G+  + F  HT
Sbjct: 456 GDTLVTGSTDRTVRVWDLRTGECKQVFYGHT 486


>SPAC227.12 |||U4/U6 x U5 tri-snRNP complex subunit Prp4
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 462

 Score = 47.2 bits (107), Expect = 2e-06
 Identities = 29/96 (30%), Positives = 47/96 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V ++A +P   D ++S+S D T  +W +     + G+      GHS  I  + 
Sbjct: 261 LEGHLARVGRVAFHPS-GDYLVSASFDTTWRLWDV-----HTGVELLMQEGHSEGIFSIA 314

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+   SG  D   R+WDL +GK+    ++H +
Sbjct: 315 CQPDGSLVSSGGNDAIGRIWDLRSGKSIMVLDEHIR 350



 Score = 43.2 bits (97), Expect = 3e-05
 Identities = 23/76 (30%), Positives = 37/76 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + + + D T+ +WK ++       P  RL GH   +  V     G+Y +S S+D T RLW
Sbjct: 238 LATGAADNTVCLWKASQST-----PLLRLEGHLARVGRVAFHPSGDYLVSASFDTTWRLW 292

Query: 311 DLAAGKTTRRFEDHTK 358
           D+  G      E H++
Sbjct: 293 DVHTGVELLMQEGHSE 308



 Score = 29.5 bits (63), Expect = 0.42
 Identities = 13/40 (32%), Positives = 22/40 (55%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           I+ V  S++GN+  SGSW   +++W+       + F  HT
Sbjct: 175 IAIVRFSNNGNHFASGSWGGQVKVWNSDNLSEVQLFRGHT 214


>SPBPJ4664.04 |||coatomer alpha subunit |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1207

 Score = 46.4 bits (105), Expect = 3e-06
 Identities = 29/88 (32%), Positives = 46/88 (52%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL  +L GH  +V     + +YP  ILS S D+T+ +W   +  N   I    L GHSH+
Sbjct: 86  KLLFSLCGHMDYVRVCTFHHEYP-WILSCSDDQTIRIWNW-QSRNCIAI----LTGHSHY 139

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           +         +  +S S D+T+R+WD++
Sbjct: 140 VMCAAFHPSEDLIVSASLDQTVRVWDIS 167



 Score = 44.4 bits (100), Expect = 1e-05
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 3/96 (3%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V   A +P  P +ILS+  D+ + +W++T  +  + +   R  GH + +S  +
Sbjct: 208 LEGHDRGVNWCAFHPTLP-LILSAGDDRLVKLWRMTASKA-WEVDTCR--GHFNNVSCCL 263

Query: 251 LSSDGNYALSGSWDKTLRLWDL---AAGKTTRRFED 349
                   LS S DKT+R+WDL    A +T RR  D
Sbjct: 264 FHPHQELILSASEDKTIRVWDLNRRTAVQTFRRDND 299


>SPAC4D7.05 |sum1|tif34|translation initiation factor
           eIF3i|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 328

 Score = 46.4 bits (105), Expect = 3e-06
 Identities = 30/97 (30%), Positives = 49/97 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   +TQI  N    D++ S ++DK + VW  + +    G  +    GH+  I    
Sbjct: 6   LQGHERPLTQIKYNHD-GDLLFSCAKDKVINVW-FSHNGERLGTYE----GHTGAIWTCD 59

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           ++      +SG+ D T+RLWD+  GK   ++E  T V
Sbjct: 60  INKSSTLMVSGAADNTMRLWDVKTGKQLYKWEFPTAV 96


>SPAC29E6.01 |pof11|SPAC30.05, mug156|F-box protein
           Pof11|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 506

 Score = 45.6 bits (103), Expect = 6e-06
 Identities = 30/94 (31%), Positives = 41/94 (43%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +  Y   I+SSSRD T  VW+L             L GH   ++ V  S
Sbjct: 301 GHTDNVLGVVVSENY---IISSSRDHTARVWRLDATSPAEACMHV-LRGHLASVNSVQYS 356

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           S     ++ S D+TLR WD+  G   R    H +
Sbjct: 357 SKTGLIVTASSDRTLRTWDITTGHCIRIIHAHQR 390



 Score = 41.9 bits (94), Expect = 7e-05
 Identities = 27/94 (28%), Positives = 49/94 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH   V  +  + K   +I+++S D+TL  W +T      G   + ++ H   I+   
Sbjct: 343 LRGHLASVNSVQYSSK-TGLIVTASSDRTLRTWDITT-----GHCIRIIHAHQRGIA--C 394

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +G + +SGS D T+R+++ ++GK  R  + H
Sbjct: 395 AQYNGKFIVSGSSDLTIRIFEASSGKLLRMLQGH 428



 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 1/81 (1%)
 Frame = +2

Query: 116 KYPDMIL-SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           +Y D I+ S S+D+T+ VW    D N+  I  K LYGHS  +  +      N  +SGS D
Sbjct: 228 QYDDEIMVSGSKDRTVSVW----DVNSRFILYK-LYGHSGSVLCLDFCRRRNLLVSGSSD 282

Query: 293 KTLRLWDLAAGKTTRRFEDHT 355
            T+ +WD    +  + +  HT
Sbjct: 283 STIIIWDWQNRRPLKVYFGHT 303


>SPBC15D4.14 |taf73||TATA-binding protein associated factor
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 642

 Score = 44.8 bits (101), Expect = 1e-05
 Identities = 25/92 (27%), Positives = 42/92 (45%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GHN  +  +  +P +     ++S D+T  +W +      +  P +   GH + +  V   
Sbjct: 443 GHNAPIWDVQFSP-FGYYFATASHDQTARLWDV-----EHAAPLRVFVGHQNDVDCVSFH 496

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  Y  +GS D T R+WD+  G T R F  H
Sbjct: 497 PNAAYLATGSSDHTTRMWDVRTGGTVRVFNAH 528



 Score = 27.1 bits (57), Expect = 2.2
 Identities = 15/54 (27%), Positives = 23/54 (42%)
 Frame = +2

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           N  + +  L GH+  +  V +S    + LS S D   RLW      T  ++  H
Sbjct: 391 NEPLQKSSLIGHTRPVFGVSISPQKEFILSCSEDGFTRLWSKDTKSTIVKYAGH 444



 Score = 26.2 bits (55), Expect = 3.9
 Identities = 21/95 (22%), Positives = 38/95 (40%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  ++ +P    +   SS D T  +W +       G   +    H   +S + +S
Sbjct: 485 GHQNDVDCVSFHPNAAYLATGSS-DHTTRMWDVRT-----GGTVRVFNAHHSPVSALCMS 538

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +DG    S      +++WDL +      F  H+ +
Sbjct: 539 ADGLSLASADESGIIKVWDLRSSNQHVSFVKHSSI 573


>SPBC16C6.13c |sec27||coatomer beta' subunit |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 796

 Score = 41.9 bits (94), Expect = 7e-05
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 2/98 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH+ +V  +A NPK  +   SS  D T+ VW       N+      L  H   ++ V
Sbjct: 136 TFEGHSRYVMSLAINPKDTNTFASSCLDGTVKVWSFGSSVANF-----TLQAHDRGVNYV 190

Query: 248 --VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               + D  Y ++   D  +++WD       R  E HT
Sbjct: 191 NYYPAGDKPYLITAGDDNLIKVWDYQTKACVRILEGHT 228



 Score = 25.4 bits (53), Expect = 6.8
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLI-VWKLTRDENNYGIPQKRLYGHSHFISD 244
           TL+ H+  V  +   P      L ++ D  LI VW     +       + L GH++ +S 
Sbjct: 179 TLQAHDRGVNYVNYYPAGDKPYLITAGDDNLIKVW-----DYQTKACVRILEGHTNNVSF 233

Query: 245 VVLSSDGNYALSGSWDKTLRLW 310
               S     +SGS D T+++W
Sbjct: 234 AFFHSKFPIIISGSEDGTVKIW 255


>SPAC343.04c |gnr1||heterotrimeric G protein beta subunit
           Gnr1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 507

 Score = 41.9 bits (94), Expect = 7e-05
 Identities = 26/86 (30%), Positives = 44/86 (51%)
 Frame = +2

Query: 89  WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGN 268
           W    + N +Y   + S+S+DKT I++ +   +  +     RL GH   ++ +  S D  
Sbjct: 217 WQISYSHNGRY---LASASKDKTAIIFDVVNLKRVF-----RLIGHIDTVAYIRWSPDDR 268

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFE 346
           Y LS S DK++ LWD   G+  R ++
Sbjct: 269 YLLSCSCDKSVILWDAFTGEKLRDYK 294



 Score = 31.9 bits (69), Expect = 0.078
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           E+ KL  TL GH   V  +A NP  P    S+  D T+ +W
Sbjct: 458 ESGKLLATLSGHVKCVNYVAYNPVDPYQFASAGDDNTVRIW 498



 Score = 31.5 bits (68), Expect = 0.10
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ + LS D  YAL+     T  LWDL   +  R++  H
Sbjct: 386 VTSICLSKDSKYALTNLEPHTTFLWDLEENRIVRQYMGH 424



 Score = 29.9 bits (64), Expect = 0.31
 Identities = 21/76 (27%), Positives = 31/76 (40%), Gaps = 1/76 (1%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF-ISDVVLSSDGNYALSGSWDKTLRLW 310
           L++    T  +W L   E N  + Q   +   +F I       D  + LSGS D  +R+W
Sbjct: 399 LTNLEPHTTFLWDL---EENRIVRQYMGHKLGNFLIGSCFGGKDDTFVLSGSEDDKIRIW 455

Query: 311 DLAAGKTTRRFEDHTK 358
              +GK       H K
Sbjct: 456 HRESGKLLATLSGHVK 471



 Score = 26.2 bits (55), Expect = 3.9
 Identities = 14/45 (31%), Positives = 21/45 (46%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + HS  +  +  S +G Y  S S DKT  ++D+   K   R   H
Sbjct: 210 HDHSDEVWQISYSHNGRYLASASKDKTAIIFDVVNLKRVFRLIGH 254


>SPBC32H8.07 |git5|gpb1|heterotrimeric G protein beta subunit
           Git5|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 305

 Score = 41.9 bits (94), Expect = 7e-05
 Identities = 22/60 (36%), Positives = 32/60 (53%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L  ++DKT  VW     +         L GH + IS + L+SDG    +GSWD+ +RLW
Sbjct: 247 LLFIAKDKTCEVWDSISSKTITS-----LTGHENRISSLALTSDGTMLATGSWDECVRLW 301



 Score = 33.9 bits (74), Expect = 0.019
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH+ F+S      DG + L+GS DKT   WD+   K     + H
Sbjct: 102 LVGHAGFVSCCKYVDDG-HLLTGSGDKTCMFWDIEQAKAISVLKGH 146



 Score = 33.1 bits (72), Expect = 0.034
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           I D+ +S+DG Y LS S +  L +WDL        FE
Sbjct: 24  IPDIDISTDGKYLLSASTNDVLLVWDLHTSNKVAFFE 60


>SPAC343.17c |||WD repeat protein, human WDR70
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 576

 Score = 41.5 bits (93), Expect = 1e-04
 Identities = 25/75 (33%), Positives = 34/75 (45%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           VT  A NP  PD   ++  D ++  W+         +  K  +     IS +  S DGNY
Sbjct: 253 VTSCAWNPAKPDNFATAVLDGSIQFWQKGSRTKRPVMKIKDAHLPQQGISCLSFSQDGNY 312

Query: 272 ALSGSWDKTLRLWDL 316
            LS   D  LR+WDL
Sbjct: 313 LLSRGEDNALRVWDL 327



 Score = 30.3 bits (65), Expect = 0.24
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GHS  ++      +G+   +GS D T+  WDL
Sbjct: 87  GHSKIVTTTTFDKNGSRFYTGSLDNTIHCWDL 118



 Score = 27.9 bits (59), Expect = 1.3
 Identities = 14/58 (24%), Positives = 26/58 (44%)
 Frame = +2

Query: 17  SLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN 190
           SL   FSK  + ++     +GH   +T     P    + L++  D T  +W + R ++
Sbjct: 175 SLIVRFSKGDQYIRNMYNTKGHIAEITDGCWQPDSSQIFLTTGYDSTARIWDVNRTKS 232


>SPBC713.04c |||U3 snoRNP-associated protein
           Utp1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 854

 Score = 41.5 bits (93), Expect = 1e-04
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH   +S +  +S G+   SGSWDKT+R+WD+
Sbjct: 463 LAGHEGPVSSLSFNSSGSLLASGSWDKTVRIWDI 496



 Score = 37.1 bits (82), Expect = 0.002
 Identities = 32/110 (29%), Positives = 50/110 (45%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           +G    F+ F    +T +L  TL GH G V+ ++ N     ++ S S DKT+ +W +   
Sbjct: 441 AGSQDSFEIFMWSVQTGQLLETLAGHEGPVSSLSFNSS-GSLLASGSWDKTVRIWDIF-- 497

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
            +  GI +  L   S  +S +    DG      S D  L  W++  GK T
Sbjct: 498 -SRSGIVEP-LPIPSDVLS-LAFHPDGKEVCVASLDGQLTFWNVQEGKQT 544



 Score = 36.3 bits (80), Expect = 0.004
 Identities = 28/114 (24%), Positives = 54/114 (47%)
 Frame = +2

Query: 14  SSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN 193
           S LF  +   S T+  + ++   N  +  +  N     + + SS+   L+VW+   +  +
Sbjct: 275 SGLFGIYELPSFTMLYQLSITQSN--IDTLTVNSTGDWIAIGSSKLGQLLVWEWQSE--S 330

Query: 194 YGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           Y + Q+    H   +S +  SSDG   ++G+ D  +++WD+ +G     F  HT
Sbjct: 331 YVLKQQ---SHYDALSTLQYSSDGQRIITGADDGKIKVWDMNSGFCIVTFTQHT 381



 Score = 25.0 bits (52), Expect = 9.0
 Identities = 10/36 (27%), Positives = 20/36 (55%)
 Frame = +2

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           + +  S+DG+  LS    K + L+D+  G   ++F+
Sbjct: 575 TSICYSADGSCVLSAGTSKYVCLYDIITGVLIKKFQ 610


>SPAC31A2.14 |||WD repeat protein, human WRDR48
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 962

 Score = 41.1 bits (92), Expect = 1e-04
 Identities = 18/60 (30%), Positives = 30/60 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S  RD  L  W +  D      P  ++  HS +++D+ L+ D    +S S D T++LW
Sbjct: 47  LYSGGRDGQLFGWDIGYDYGKASQPLAKIQAHSAWVNDIALTHDSEGVISCSSDSTVKLW 106



 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           L GH+  + D+++S DG   L+ S D T++LW L A K    F  H+
Sbjct: 212 LVGHTDNVRDILISDDGRTILTASSDATIKLWSLRAQKCLFSFIAHS 258



 Score = 34.3 bits (75), Expect = 0.015
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 2/94 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++ H+ WV  IA      + ++S S D T+ +WK     N   +    +  H+ ++  V 
Sbjct: 75  IQAHSAWVNDIALTHD-SEGVISCSSDSTVKLWK-PHVLNASCL--STIGEHTDYVKRVS 130

Query: 251 LS--SDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +   S      SG  DK + +WD   G+   RFE
Sbjct: 131 IPKYSKSPLVASGGLDKRIIVWDYNVGQEVMRFE 164


>SPAC664.15 |||CCR4-Not complex subunit Caf4/Mdv1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 651

 Score = 41.1 bits (92), Expect = 1e-04
 Identities = 22/65 (33%), Positives = 35/65 (53%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S + D  + +W L       G+P +   GH+  IS   L  D N+  SGS+D ++R+W
Sbjct: 509 VASGTVDGLIRIWDL-----RIGLPVRSFIGHTAPISS--LQFDSNHLYSGSYDNSVRIW 561

Query: 311 DLAAG 325
           DL +G
Sbjct: 562 DLRSG 566



 Score = 38.3 bits (85), Expect = 9e-04
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 16/104 (15%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD--------ENNYGIPQKR-- 214
           G+L+GH+ +V+ +A    +   I + S D T+ +W L  D        E +   P  +  
Sbjct: 368 GSLKGHSDYVSCLAIQDSF---IATGSMDTTVRLWNLDNDVLHKDNPVEESLNSPPDQPV 424

Query: 215 ------LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
                 L  H+  ++ + LSSD +  ++G+ DKT+R WD+  G+
Sbjct: 425 DNATNVLTSHTAPVTALALSSD-DVLITGADDKTVRQWDIVTGR 467



 Score = 31.1 bits (67), Expect = 0.14
 Identities = 21/64 (32%), Positives = 25/64 (39%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           VW  T D +   I     Y    FI    L        SG+ D  +R+WDL  G   R F
Sbjct: 475 VWAETHDTSTSQILVSDTYKQEPFIR--ALDCLDAAVASGTVDGLIRIWDLRIGLPVRSF 532

Query: 344 EDHT 355
             HT
Sbjct: 533 IGHT 536



 Score = 29.9 bits (64), Expect = 0.31
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           K+   HS +I+ +  S       + S DKT+++WD+A
Sbjct: 326 KQFQAHSEYITSLDFSHPFGTLATASTDKTVKVWDMA 362


>SPCC126.01c ||SPCC576.18c|conserved fungal
           protein|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 369

 Score = 41.1 bits (92), Expect = 1e-04
 Identities = 25/92 (27%), Positives = 44/92 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P+  + + ++S DKT+  W L +     GI ++    H    +DV+  
Sbjct: 220 GHQSNVYCLLFDPQDSEALWTASADKTVREWSLYQ-----GIHEETRMEHPDVCTDVLTL 274

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +DGN A +   D+ +R+WD   G     +  H
Sbjct: 275 ADGNIA-TACRDEEIRVWDTTTGNVKDIYSGH 305



 Score = 36.3 bits (80), Expect = 0.004
 Identities = 27/89 (30%), Positives = 47/89 (52%), Gaps = 4/89 (4%)
 Frame = +2

Query: 68  TLRGHNGWVT--QIATNPKYPDM--ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           T +GH+G VT  QI +  K   +  I + S D T+  W ++  E       + L GH+ +
Sbjct: 80  TYKGHSGPVTCCQIESLRKDGKVRHIYTGSWDHTIKKWNVSTGEC-----VETLIGHTDY 134

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           +  ++L  +    LSGS D +L +WD+++
Sbjct: 135 VKCLLLLEEEGLLLSGSTDASLIVWDVSS 163



 Score = 33.9 bits (74), Expect = 0.019
 Identities = 21/74 (28%), Positives = 34/74 (45%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I ++ RD+ + VW  T          K +Y   H+ S   +    +Y +S S D+T+R+W
Sbjct: 279 IATACRDEEIRVWDTTTGN------VKDIYS-GHYESVTKILQWKSYLISSSLDQTIRVW 331

Query: 311 DLAAGKTTRRFEDH 352
           DL         +DH
Sbjct: 332 DLEYSADNNEADDH 345



 Score = 29.9 bits (64), Expect = 0.31
 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 2/37 (5%)
 Frame = +2

Query: 251 LSSDGN--YALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           L  DG   +  +GSWD T++ W+++ G+       HT
Sbjct: 96  LRKDGKVRHIYTGSWDHTIKKWNVSTGECVETLIGHT 132



 Score = 25.0 bits (52), Expect = 9.0
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN 193
           GH   VT+I     Y   ++SSS D+T+ VW L    +N
Sbjct: 304 GHYESVTKILQWKSY---LISSSLDQTIRVWDLEYSADN 339


>SPBC1289.11 |spf38|cwf17|splicing factor Spf38|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 340

 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 26/95 (27%), Positives = 39/95 (41%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V     +P       S   D+ +++W +  D  NYG+    L G    I+D+  S
Sbjct: 48  GHTAEVLVARFDPS-GSYFASGGMDRQILLWNVFGDVKNYGV----LNGCKGAITDLQWS 102

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            D       S D  L  WD  +G+  R+ + H  V
Sbjct: 103 RDSRVVYCSSSDTHLMSWDAVSGQKIRKHKGHAGV 137



 Score = 34.7 bits (76), Expect = 0.011
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
           L GH   I+ + +S DG+  LS S D T+R++D+    + +R
Sbjct: 215 LKGHKDIITSLAISKDGSSLLSNSMDNTVRIFDVKPFASAQR 256



 Score = 32.3 bits (70), Expect = 0.059
 Identities = 21/56 (37%), Positives = 29/56 (51%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           G  S  K     S T  LR  L GH G V  +  +P + D+ILS S D+T+ + +L
Sbjct: 285 GAGSSDKNVYVWSATGDLRYVLPGHEGSVNHVDFHP-HQDIILSCSSDRTIFLGEL 339



 Score = 29.9 bits (64), Expect = 0.31
 Identities = 13/58 (22%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +2

Query: 146 RDKTLIV-WKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +D +LI    + +  ++  +P  +++GH+  +        G+Y  SG  D+ + LW++
Sbjct: 22  QDSSLITEGSVLQRTSDLNVPNLQMFGHTAEVLVARFDPSGSYFASGGMDRQILLWNV 79



 Score = 28.7 bits (61), Expect = 0.73
 Identities = 20/96 (20%), Positives = 39/96 (40%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH G V  +       +++ S S D T+ VW     +    I +K      + ++ V +
Sbjct: 132 KGHAGVVNALDVLKVGSELLTSVSDDCTMKVWDSRSKDCIKTIEEK------YPLTAVAI 185

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +  G     G  D  +++WDL     +   + H  +
Sbjct: 186 AQQGTQVFIGGIDGAIKIWDLRNNHCSHVLKGHKDI 221


>SPBC1773.01 |||striatin homolog|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 612

 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 31/109 (28%), Positives = 49/109 (44%), Gaps = 9/109 (8%)
 Frame = +2

Query: 35  SKMSETLKLRGTLR--GHNGWVTQIATNPKYPDM---ILSSSRDKTLIVWKLTRD--ENN 193
           SK  +  + + TL+     G  TQ  T+   P       S + +  + VW+L  D  +N+
Sbjct: 266 SKAKKKKEQKWTLKFESDKGTSTQCITHQPLPGSTPSFASGTENGVINVWRLDEDSNDNS 325

Query: 194 YGI--PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
            GI  P    YGH   +  V +    ++  SG  D T+R W L A +T+
Sbjct: 326 MGIIKPHLTFYGHEGPVLCVCVPKATHHIFSGGHDGTIRCWSLPANQTS 374


>SPBC577.09 |||ERCC-8 homolog |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 404

 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 9/100 (9%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR--------DENNYGIPQKRL-Y 220
           +L GH G V  +   PK   ++ S S D T  +W + +        D +N  +P  +   
Sbjct: 184 SLSGHTGNVLAVDWCPKNEFVLASGSADGTCRLWDIRKVSSSFACMDLHNKYLPSNQTNI 243

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
            H   ++ +  +SD  Y  S   D  +R+W++ +G+ T R
Sbjct: 244 SHYGTVNGLAWTSDARYLASCGTDDRIRVWNMESGRNTLR 283



 Score = 27.5 bits (58), Expect = 1.7
 Identities = 26/103 (25%), Positives = 41/103 (39%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +TL        H   +T +   P    +  SSS D TL VW ++  +  Y    + +  +
Sbjct: 91  DTLNAVPARTSHKFGITDLHWFPFDNGIFTSSSFDHTLKVWDVSTLQEAYTFTMEDMI-Y 149

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           SH  S +        A   S   ++RL D+ +G  T     HT
Sbjct: 150 SHAWSPIASHCLIATAYRSS---SIRLCDMQSGSYTHSLSGHT 189


>SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6
           family|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 984

 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 27/74 (36%), Positives = 36/74 (48%), Gaps = 1/74 (1%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGHSHFISDVVLSSDGNYA 274
           QI+ N  Y   I S+S  + + VWK   +     +     L GH     D+  SSDG Y 
Sbjct: 153 QISGNEIY---IASASAFQQIYVWKFNYNNPPSCVSIDTYLVGHEGACFDLKFSSDGRYL 209

Query: 275 LSGSWDKTLRLWDL 316
            S S D+TLRLW +
Sbjct: 210 CSVSEDRTLRLWSI 223


>SPAC25H1.08c |||ribosome biogenesis protein
           Sqt1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 399

 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 25/82 (30%), Positives = 36/82 (43%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   V  ++ NP + ++  S   D    +W +T  E    I Q  L GH   I  +  S 
Sbjct: 60  HKDSVFSVSINPVHSNLCASGGGDDLGYIWDITTGEQ---ICQ--LTGHKDSIVAIDWSF 114

Query: 260 DGNYALSGSWDKTLRLWDLAAG 325
           DG Y  +G  D  +RLW  + G
Sbjct: 115 DGTYIATGGMDSQVRLWKSSTG 136


>SPAC23C4.02 |crn1||actin binding protein, coronin
           Crn1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 601

 Score = 39.9 bits (89), Expect = 3e-04
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 6/90 (6%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD----ENNYGI-PQKRLYGHSHFI 238
           RGH   V     NP +  ++ S   D  +++WK+  D    E    + P   L GHS  +
Sbjct: 78  RGHTAAVLDTDWNPFHDQVLASGGDDSKIMIWKVPEDYTVMEPYEDVHPIAELKGHSRKV 137

Query: 239 SDVVL-SSDGNYALSGSWDKTLRLWDLAAG 325
             V    +  N   S S D T++LWD   G
Sbjct: 138 GLVQYHPTAANVLASSSADNTIKLWDCEKG 167



 Score = 33.5 bits (73), Expect = 0.026
 Identities = 20/81 (24%), Positives = 39/81 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH+  V  +  +P   +++ SSS D T+ +W   +   +  +    +     F     
Sbjct: 130 LKGHSRKVGLVQYHPTAANVLASSSADNTIKLWDCEKGVAHVSLKMDVMCQSMSF----- 184

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            ++DG   ++ S DK +R+WD
Sbjct: 185 -NADGTRLVTTSRDKKVRVWD 204


>SPAC57A10.05c |pof1||F-box protein Pof1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 605

 Score = 38.7 bits (86), Expect = 7e-04
 Identities = 27/86 (31%), Positives = 41/86 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  VT +  +      ++S S DKT+ +W       NY   +     H H  S + 
Sbjct: 309 LEGHSSGVTCLQFDQC---KLISGSMDKTIRIW-------NYRTSECISILHGHTDSVLC 358

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
           L+ D    +SGS D T++LW  + GK
Sbjct: 359 LTFDSTLLVSGSADCTVKLWHFSGGK 384



 Score = 35.5 bits (78), Expect = 0.006
 Identities = 21/75 (28%), Positives = 35/75 (46%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           +++S S D T+ +W  +      G  +  L GH+  ++ V +  D    LSGS D T+++
Sbjct: 365 LLVSGSADCTVKLWHFS------GGKRITLRGHTGPVNSVRIIRDRGLVLSGSDDSTIKI 418

Query: 308 WDLAAGKTTRRFEDH 352
           W L        F  H
Sbjct: 419 WSLETNTCLHTFSAH 433



 Score = 32.7 bits (71), Expect = 0.045
 Identities = 22/77 (28%), Positives = 35/77 (45%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +++ S S D T+ +W L   +         L GHS  ++   L  D    +SGS DKT+R
Sbjct: 284 NILASGSYDATIRLWNLATFQQ-----VALLEGHSSGVT--CLQFDQCKLISGSMDKTIR 336

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+    +       HT
Sbjct: 337 IWNYRTSECISILHGHT 353



 Score = 32.3 bits (70), Expect = 0.059
 Identities = 18/47 (38%), Positives = 25/47 (53%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           L GHS  +  + L    N   SGS+D T+RLW+LA  +     E H+
Sbjct: 269 LSGHSDGV--MCLQLVRNILASGSYDATIRLWNLATFQQVALLEGHS 313


>SPBC27B12.05 |||WD repeat protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 391

 Score = 37.9 bits (84), Expect = 0.001
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           L GH H I  +  +S G   LSGS D++L++WD+ +
Sbjct: 97  LEGHEHNIPCITFNSSGTLLLSGSIDRSLQIWDITS 132


>SPBC215.15 |sec13||COPII-coated vesicle component
           Sec13|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 297

 Score = 37.1 bits (82), Expect = 0.002
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVWKLT 178
           K FS  +    L  TLRGH+G V Q+   +PK+  ++ S+S D  +IVW+ T
Sbjct: 34  KVFSIENNQQTLLETLRGHSGPVWQLGWAHPKFGTILASASYDGHVIVWRET 85


>SPBC14C8.17c |||SAGA complex subunit Spt8 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 526

 Score = 37.1 bits (82), Expect = 0.002
 Identities = 22/65 (33%), Positives = 32/65 (49%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +LS   +  +I++  TR +  Y  P   L  H+  +S + L       LSGSWDK +  W
Sbjct: 203 VLSGVNNGDIILYS-TRHQEGY--PVTSLKKHTAPVSCLALHGSEKKVLSGSWDKMVYYW 259

Query: 311 DLAAG 325
           DL  G
Sbjct: 260 DLNTG 264


>SPBC428.19c |||U3 snoRNP protein Utp15 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 494

 Score = 36.7 bits (81), Expect = 0.003
 Identities = 23/60 (38%), Positives = 30/60 (50%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           LS S DKT+ VW L+      G  Q  L GH  ++      S     +SG +D T+RLWD
Sbjct: 140 LSGSDDKTVKVWDLST-----GAVQYDLSGHEDYVRTASWMS-ATRLVSGGYDGTIRLWD 193



 Score = 31.1 bits (67), Expect = 0.14
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 2/78 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S   D T+ +W     +     P+   + H   I DVVL       +  +   ++++W
Sbjct: 180 LVSGGYDGTIRLW-----DTRIADPEVMSFSHGEAI-DVVLPMQSGSTVISAGGPSIKVW 233

Query: 311 DLAAGK--TTRRFEDHTK 358
           DL AG+   T++  +H K
Sbjct: 234 DLVAGRQTPTKKLSNHQK 251



 Score = 29.5 bits (63), Expect = 0.42
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +2

Query: 275 LSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LSGS DKT+++WDL+ G        H
Sbjct: 140 LSGSDDKTVKVWDLSTGAVQYDLSGH 165


>SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 932

 Score = 36.7 bits (81), Expect = 0.003
 Identities = 24/101 (23%), Positives = 43/101 (42%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G  S F    K +E  +    L GH+  +  +  +     +++S   D ++IVW  T  E
Sbjct: 109 GLGSTFGSGEKHTENWRSYRRLLGHDNDIQDLCWSYD-SQLVVSVGLDSSIIVWNGTTFE 167

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
                  KR+  H   +  +     G Y  + S D+T+++W
Sbjct: 168 R-----LKRIEAHQSHVKGITFDPAGKYFATESDDRTIKVW 203



 Score = 33.9 bits (74), Expect = 0.019
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 13/104 (12%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD----ENNYGIPQK---------RLY 220
           H G VT +  +P     + S S D+ +I+W          + +G  +K         RL 
Sbjct: 73  HTGTVTSVRFSPN-GQYLASGSDDRVVIIWHKEEAIPGLGSTFGSGEKHTENWRSYRRLL 131

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH + I D+  S D    +S   D ++ +W+    +  +R E H
Sbjct: 132 GHDNDIQDLCWSYDSQLVVSVGLDSSIIVWNGTTFERLKRIEAH 175



 Score = 28.7 bits (61), Expect = 0.73
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 9/88 (10%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL------TRDEN-NYGIPQKR--LYGH 226
           RGH   +  I  +P     I +   D T+ +W          +EN N  +P++   +  H
Sbjct: 15  RGHRLSIFSIHIHPD-GSRIATGGLDGTIRIWSTEAINRENENENENEDLPKQLCCMSTH 73

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +  ++ V  S +G Y  SGS D+ + +W
Sbjct: 74  TGTVTSVRFSPNGQYLASGSDDRVVIIW 101



 Score = 26.2 bits (55), Expect = 3.9
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           GH   I  + +  DG+   +G  D T+R+W   A
Sbjct: 16  GHRLSIFSIHIHPDGSRIATGGLDGTIRIWSTEA 49


>SPBC713.05 |||WD repeat protein, human MAPK organizer 1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 297

 Score = 36.3 bits (80), Expect = 0.004
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           S   DK + VW +     N G   +RL GH   I+ +  + D +   SGS+D  +RLWD
Sbjct: 73  SCGGDKFIQVWDV-----NTGKVDRRLGGHLAQINTIRYNEDSSILASGSFDSKVRLWD 126



 Score = 35.9 bits (79), Expect = 0.005
 Identities = 17/44 (38%), Positives = 22/44 (50%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH H I D+ L  D     S   DK +++WD+  GK  RR   H
Sbjct: 54  GHGHEILDLDLVYDSTKFASCGGDKFIQVWDVNTGKVDRRLGGH 97



 Score = 26.2 bits (55), Expect = 3.9
 Identities = 10/39 (25%), Positives = 20/39 (51%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           I+ V  +  G Y L+   ++ +RLW++ +G     +  H
Sbjct: 17  INVVKYNRTGKYVLAAGNERVVRLWNVKSGACIHEYAGH 55


>SPBC1711.16 |||WD repeat protein Pwp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 516

 Score = 36.3 bits (80), Expect = 0.004
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+ H+G ++ ++ NP  P  + + S D+ + +W  T D +   +  + L     F     
Sbjct: 379 LQAHDGPISCLSVNPSVPSFVATGSTDRVVKLWN-TSDSSPKMVVSRDLDVGRVFTCSFT 437

Query: 251 LSSDGNYALSGSWDK-TLRLWDLAAGKTTRR 340
                 + L+ S  K  +R+WD A     R+
Sbjct: 438 TDESTAFHLAASGSKGVVRVWDTATNPGVRK 468



 Score = 31.1 bits (67), Expect = 0.14
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGN---YALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           K++    H  + + LSS+ N     +SGS D TL+LWDL+     + F  H+
Sbjct: 246 KKINDSYHTDAVLALSSNRNAHNLLVSGSADTTLKLWDLSTCNCVKSFTYHS 297



 Score = 30.7 bits (66), Expect = 0.18
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 1/90 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   V  +++N    ++++S S D TL +W L+          K    HS  +S +   S
Sbjct: 253 HTDAVLALSSNRNAHNLLVSGSADTTLKLWDLSTCNC-----VKSFTYHSDKVSCLDWYS 307

Query: 260 DG-NYALSGSWDKTLRLWDLAAGKTTRRFE 346
              +  LSGS+DKT ++ DL   +    F+
Sbjct: 308 KAPSVLLSGSYDKTAKIADLRLEEAPSSFQ 337



 Score = 25.8 bits (54), Expect = 5.1
 Identities = 8/21 (38%), Positives = 14/21 (66%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWDL 316
           ++ GNY   G++D  + +WDL
Sbjct: 199 NAPGNYVAVGTFDPEIEIWDL 219


>SPBC609.03 |||WD repeat protein, human IQWD1
           family|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 809

 Score = 35.9 bits (79), Expect = 0.005
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           QK L GH+  ++ +  S+DG + LSGS D  L +WD+
Sbjct: 38  QKELTGHTGCVNTLDWSADGEFLLSGSDDTRLIVWDV 74


>SPAC29A4.18 |prw1||Clr6 histone deacetylase complex subunit
           Prw1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 431

 Score = 35.9 bits (79), Expect = 0.005
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 1/85 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           ++  H+G +  +A NP    ++ + S DKT+ +W    D  N       L GH   ++ +
Sbjct: 276 SVHAHSGPIHSVAFNPHNDFILATCSTDKTIALW----DLRNLNQRLHTLEGHEDIVTKI 331

Query: 248 VLSSDGNYAL-SGSWDKTLRLWDLA 319
             S      L S S D+   +WDL+
Sbjct: 332 SFSPHEEPILASTSADRRTLVWDLS 356



 Score = 35.5 bits (78), Expect = 0.006
 Identities = 25/91 (27%), Positives = 45/91 (49%), Gaps = 10/91 (10%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR-------DENNYGIPQKRLY-- 220
           TL GH   VT+I+ +P    ++ S+S D+  +VW L+R       +E   G P+      
Sbjct: 320 TLEGHEDIVTKISFSPHEEPILASTSADRRTLVWDLSRIGEDQPAEEAQDGPPELLFMHG 379

Query: 221 GHSHFISDVVLSSDGNYAL-SGSWDKTLRLW 310
           GH+    D+    + N+ + + + D  L++W
Sbjct: 380 GHTSCTIDMDWCPNYNWTMATAAEDNILQIW 410


>SPCC895.06 |||RNA polymerase II elongator complex subunit Elp2
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 760

 Score = 35.9 bits (79), Expect = 0.005
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWK 172
           L GH  WV  +  +P   +MILSSS D ++IVW+
Sbjct: 264 LMGHEDWVMSVDWHPT-KEMILSSSADSSMIVWE 296



 Score = 31.5 bits (68), Expect = 0.10
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 4/42 (9%)
 Frame = +2

Query: 71  LRGHNG---WVTQIATNPKYPD-MILSSSRDKTLIVWKLTRD 184
           + GH+G    V ++ATN +Y    ILS + DKTL +W+L  +
Sbjct: 47  MAGHSGRINCVCELATNSEYRSPFILSGASDKTLRLWQLEEE 88



 Score = 29.1 bits (62), Expect = 0.55
 Identities = 12/48 (25%), Positives = 23/48 (47%)
 Frame = +2

Query: 167 WKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           W+L + +    +    + GH+  +  V    +G + LS   D+T RL+
Sbjct: 350 WRLWKQDAGQWLQLPSISGHTKSVKGVAWDPEGKFYLSAGTDQTTRLF 397



 Score = 27.9 bits (59), Expect = 1.3
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 5/37 (13%)
 Frame = +2

Query: 221 GHSHFISDVV-LSSDGNYA----LSGSWDKTLRLWDL 316
           GHS  I+ V  L+++  Y     LSG+ DKTLRLW L
Sbjct: 49  GHSGRINCVCELATNSEYRSPFILSGASDKTLRLWQL 85



 Score = 26.2 bits (55), Expect = 3.9
 Identities = 12/45 (26%), Positives = 23/45 (51%), Gaps = 2/45 (4%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPD--MILSSSRDKTLIVWKLT 178
           + KL+  LRGH  WV  ++          + S S+D+ + +W ++
Sbjct: 180 SFKLKAVLRGHLDWVRTLSFKKTSGSTATLASGSQDRYIRLWNIS 224


>SPCC1672.07 |||U3 snoRNP-associated protein Utp21
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 902

 Score = 35.5 bits (78), Expect = 0.006
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           + L+GHS+ ++    S  G + ++ S D T+R WDL  G
Sbjct: 566 RELWGHSNRLTSFDFSDTGRWLVTASLDGTIRTWDLPTG 604


>SPAC3H5.08c |||WD repeat protein Wdr44 family|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 855

 Score = 35.1 bits (77), Expect = 0.008
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 1/65 (1%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTL 301
           + +LSSS DKT  +W   R +          + HS F++ +     D  + LSGS D  L
Sbjct: 321 NFLLSSSMDKTARLWHPVRKDCLC------CFEHSDFVTSIAFHPKDDRFFLSGSLDCKL 374

Query: 302 RLWDL 316
           RLW +
Sbjct: 375 RLWSI 379



 Score = 31.1 bits (67), Expect = 0.14
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 5/93 (5%)
 Frame = +2

Query: 95  TQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD--VVLSSDGN 268
           TQ+  N      +L ++ D  + ++ L RD++     + +  GH++  S        DGN
Sbjct: 451 TQMIDNIAGDTEMLVTTNDSRIRIYNL-RDKSL----ELKFKGHANAQSQNRAYFDDDGN 505

Query: 269 YALSGSWDKTLRLWDLA---AGKTTRRFEDHTK 358
           Y + GS D  + +WDL      KT ++  +H K
Sbjct: 506 YVICGSEDHQVFIWDLPPQHMHKTKKKKHEHFK 538



 Score = 30.7 bits (66), Expect = 0.18
 Identities = 21/70 (30%), Positives = 33/70 (47%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+ +VT IA +PK     LS S D  L +W +     ++      L      I+ V  S 
Sbjct: 348 HSDFVTSIAFHPKDDRFFLSGSLDCKLRLWSIKEKAVSFWNELPEL------ITAVAFSP 401

Query: 260 DGNYALSGSW 289
           DG  A++G++
Sbjct: 402 DGGLAIAGTF 411



 Score = 30.3 bits (65), Expect = 0.24
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           P +   GH+  I D+  S + N+ LS S DKT RLW
Sbjct: 301 PIREYAGHTADILDLSWSRN-NFLLSSSMDKTARLW 335



 Score = 25.4 bits (53), Expect = 6.8
 Identities = 11/34 (32%), Positives = 15/34 (44%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S DG Y   G  D+ LR+W +   +  R     T
Sbjct: 247 SRDGRYLAVGGQDRILRIWAVLDSEHARSVASET 280


>SPBC16A3.05c |rae1||RNA export factor Rae1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 352

 Score = 34.7 bits (76), Expect = 0.011
 Identities = 21/79 (26%), Positives = 42/79 (53%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           ++ +A +P+  + + +SS D  + ++++     + G   K LY H   +  V  S DG  
Sbjct: 33  ISDLAFSPQ-AEYLAASSWDSKVRIYEVQATGQSIG---KALYEHQGPVLSVNWSRDGTK 88

Query: 272 ALSGSWDKTLRLWDLAAGK 328
             SGS DK+ +++D+  G+
Sbjct: 89  VASGSVDKSAKVFDIQTGQ 107



 Score = 29.9 bits (64), Expect = 0.31
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = +2

Query: 278 SGSWDKTLRLWDL 316
           +GSWDKTL+ WDL
Sbjct: 135 TGSWDKTLKYWDL 147


>SPAC4F8.11 |||WD repeat protein, human WDR24
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 846

 Score = 34.3 bits (75), Expect = 0.015
 Identities = 21/87 (24%), Positives = 40/87 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RG++     +  +P  P+  +++     L  W +   +    +P  +L  H+  +  V
Sbjct: 172 TFRGNSEAARDVVFSPSEPNEFVAAYDSGILQKWDIRFPK----LPFLKLAAHNGVVLCV 227

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
             S +G +  S   DKT+R+WD  + K
Sbjct: 228 NYSPNGVFLASCGRDKTIRIWDSTSNK 254


>SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein
            homolog|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2609

 Score = 34.3 bits (75), Expect = 0.015
 Identities = 19/61 (31%), Positives = 33/61 (54%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            L++S D TL +W L+ ++      ++ LYGH + I+ V +    +  +SG     L +WD
Sbjct: 2311 LTASLDLTLRLWTLSTNKPIKASLKRVLYGHRYRITCVTVCKAFSIIVSGDAGGNLIIWD 2370

Query: 314  L 316
            L
Sbjct: 2371 L 2371



 Score = 28.3 bits (60), Expect = 0.96
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +2

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            HS  I+ VV   +  + L+ S D TLRLW L+  K
Sbjct: 2295 HSEKITHVVACDERTF-LTASLDLTLRLWTLSTNK 2328


>SPAC17D4.01 |pex7|SPAC1834.12|peroxin-7 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 308

 Score = 33.9 bits (74), Expect = 0.019
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 2/83 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  I ++    D++ ++S D T  ++    D   +   +K +  HS F+ DV 
Sbjct: 229 LSGHQLAVRSIKSSNSAHDLLATASYDMTSRIF----DPEQHSCIRK-VDLHSEFVRDVD 283

Query: 251 LSS--DGNYALSGSWDKTLRLWD 313
            S   DG++  S  WD++L +W+
Sbjct: 284 WSDFGDGSWIASVGWDESLYIWN 306



 Score = 25.8 bits (54), Expect = 5.1
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = +2

Query: 260 DGNYALSGSWDKTLRLW 310
           D    ++GSWD T++LW
Sbjct: 115 DRRIVVTGSWDGTIKLW 131


>SPAC890.04c |||ribosome biogenesis protein Ytm1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 440

 Score = 33.9 bits (74), Expect = 0.019
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           GH+  + D+V S D + A S   D T++ WDL  G+
Sbjct: 267 GHTGPVMDIVFSDDPSVAYSVGQDHTIKTWDLITGQ 302



 Score = 32.3 bits (70), Expect = 0.059
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 4/84 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN-YGIPQKRLYGHSHFISD 244
           TL GH   V+ ++ +P+ P M  S S D T  VW +     + Y I +    G      D
Sbjct: 350 TLSGHKNLVSGLSASPENPYMFASVSHDNTCRVWDVRATSGSIYTISRAEKTGSQW---D 406

Query: 245 VVLSSDGNYAL---SGSWDKTLRL 307
            + + D N ++   +G  DK L++
Sbjct: 407 KLFAVDWNKSIGIVTGGTDKQLQI 430



 Score = 27.5 bits (58), Expect = 1.7
 Identities = 14/54 (25%), Positives = 22/54 (40%)
 Frame = +2

Query: 173 LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           L  ++ + GI Q    GH   +  V      +  +S S D T+ +WD      T
Sbjct: 179 LDAEKKSSGILQTLFVGHKDIVERVRSLESSSVFISASADNTVGIWDFERSPET 232


>SPAC12G12.14c |pfs2||WD repeat protein Pfs2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 509

 Score = 33.9 bits (74), Expect = 0.019
 Identities = 30/111 (27%), Positives = 44/111 (39%), Gaps = 2/111 (1%)
 Frame = +2

Query: 32  FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
           F   +E LKL G     +GW  +         ++ S S+D  +  W     +   G    
Sbjct: 193 FHMSTEELKLTG-----HGWDVKTVDWHPSKGLLASGSKDNLVKFW-----DPRTGTCIA 242

Query: 212 RLYGHSHFISDVVLSSD--GNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            L+GH + I       +   NY  + S D T R++DL A K  R    H K
Sbjct: 243 TLHGHKNTIMQASFQKNFGSNYLATVSRDSTCRVFDLRAMKDVRVLRGHEK 293


>SPBC18H10.05 |||WD repeat protein Wdr44 family, WD repeat
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 586

 Score = 33.5 bits (73), Expect = 0.026
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GHN  V  I+ +    D +L+SS D+T+ +W     ++        ++ H+  ++ V   
Sbjct: 253 GHNAEVLSISWSKN--DFLLTSSADRTVRLWHPKSTKS------LAVFRHNEIVTCVAFH 304

Query: 257 S-DGNYALSGSWDKTLRLWDLAAGK 328
             D  Y +SGS D  ++LW +   K
Sbjct: 305 PIDDRYFVSGSLDCKIQLWSILRHK 329


>SPAC806.02c |||Par A family ATPase iron cluster assembly
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 608

 Score = 32.7 bits (71), Expect = 0.045
 Identities = 22/91 (24%), Positives = 42/91 (46%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K+ +  +    L GH   V  IA +    + + + SRDK++ +W+ T D+    +    L
Sbjct: 363 KIDDDWECTAALEGHENEVKCIAWSCN-GNYLATCSRDKSVWIWEATEDDEFDCLAV--L 419

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
             H+  +  V      +  +SGS+D ++  W
Sbjct: 420 QEHTQDVKVVTWHPTEDLLVSGSYDNSICFW 450



 Score = 31.9 bits (69), Expect = 0.078
 Identities = 21/80 (26%), Positives = 38/80 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+ H   V  +  +P   D+++S S D ++  W   RD+ +      +L GH++ +  + 
Sbjct: 419 LQEHTQDVKVVTWHPT-EDLLVSGSYDNSICFW---RDDGDDWALTCQLQGHTNTVWALA 474

Query: 251 LSSDGNYALSGSWDKTLRLW 310
            S +GN   S   D  + LW
Sbjct: 475 FSPNGNTLASADNDGNVFLW 494



 Score = 28.3 bits (60), Expect = 0.96
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L GH + +  +  S +GNY  + S DK++ +W+
Sbjct: 374 LEGHENEVKCIAWSCNGNYLATCSRDKSVWIWE 406


>SPBC32F12.02 |rec14||recombination protein
           Rec14|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 302

 Score = 32.3 bits (70), Expect = 0.059
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           G LRGH  W+  +A NP   D++LS+  +  + +W +
Sbjct: 223 GQLRGHAAWIFAVAFNP-VGDLLLSADVEGKIKIWDI 258



 Score = 31.1 bits (67), Expect = 0.14
 Identities = 23/91 (25%), Positives = 43/91 (47%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +L   L GH   V  +A +P     +L+++ D  +I        +  G    +L G
Sbjct: 174 TETGRLFHVLSGHTSPVRSVAFSPG--STLLAAAGDSKMITIYDVLSGDQVG----QLRG 227

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           H+ +I  V  +  G+  LS   +  +++WD+
Sbjct: 228 HAAWIFAVAFNPVGDLLLSADVEGKIKIWDI 258


>SPAC26H5.03 |||WD repeat protein Cac2|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 512

 Score = 32.3 bits (70), Expect = 0.059
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           I D+  S D N+ ++G+ D +LRL+D   G+   +  DH+
Sbjct: 131 IYDLCWSVDSNFLIAGAMDNSLRLYDAHTGQLLTQKFDHS 170


>SPAC9G1.05 |||actin cortical patch component Aip1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 595

 Score = 32.3 bits (70), Expect = 0.059
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           +YGH   I+   LS D  +  + S+D T+  WD+   K
Sbjct: 311 IYGHQRSITAATLSPDATHFYTASYDGTVLSWDIGKQK 348


>SPBC3D6.12 |||U3 snoRNA associted protein Dip2 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 922

 Score = 31.9 bits (69), Expect = 0.078
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +R+  H   I D+ +  DG Y  + S D T++LW L
Sbjct: 471 ERIQAHDGAIWDLAVGHDGTYFATASADHTVKLWSL 506



 Score = 27.1 bits (57), Expect = 2.2
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           LYGH   +  + +S D    ++ S DK +++W L  G
Sbjct: 572 LYGHKLPVLSMDISYDSKLLVTCSADKNVKIWGLDFG 608



 Score = 26.6 bits (56), Expect = 2.9
 Identities = 13/46 (28%), Positives = 19/46 (41%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH   ++ +     G    SGS D  + +WD+ A     R   H
Sbjct: 100 LNGHKSAVTTMDFDKMGTRLASGSMDTDIIVWDIVAETGLFRLRGH 145



 Score = 25.0 bits (52), Expect = 9.0
 Identities = 12/37 (32%), Positives = 17/37 (45%)
 Frame = +2

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           DV   S  ++ LS   D  ++LWDL+         DH
Sbjct: 178 DVDSKSSDSFLLSVGKDSFMKLWDLSIQHCVETHVDH 214


>SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 430

 Score = 31.9 bits (69), Expect = 0.078
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 1/83 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++ H+  +  +A NP    ++ ++S DKT+ +W L    N Y      L GH   +  + 
Sbjct: 277 IQAHSKAINAVAINPFNDYLLATASADKTVALWDL---RNPYQ-RLHTLEGHEDEVYGLE 332

Query: 251 LS-SDGNYALSGSWDKTLRLWDL 316
            S  D     S S D+ + +WDL
Sbjct: 333 WSPHDEPILASSSTDRRVCIWDL 355



 Score = 29.5 bits (63), Expect = 0.42
 Identities = 21/90 (23%), Positives = 37/90 (41%), Gaps = 6/90 (6%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW-----KLTRDENNYGIPQKRLYGH 226
           +  L+GH      +  NP  P  + + + D+ + +W       T  E     P  + + H
Sbjct: 175 QAVLKGHTAEGFGLCWNPNLPGNLATGAEDQVICLWDVQTQSFTSSETKVISPIAKYHRH 234

Query: 227 SHFISDVVLSSDGNYAL-SGSWDKTLRLWD 313
           +  ++DV         L S S D TL++ D
Sbjct: 235 TDIVNDVQFHPQHEALLASVSDDCTLQIHD 264



 Score = 27.5 bits (58), Expect = 1.7
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           TL GH   V  +  +P    ++ SSS D+ + +W L +
Sbjct: 320 TLEGHEDEVYGLEWSPHDEPILASSSTDRRVCIWDLEK 357


>SPBC1198.12 |mfr1|SPBC660.02|fizzy-related protein
           Mfr1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 421

 Score = 31.5 bits (68), Expect = 0.10
 Identities = 25/103 (24%), Positives = 43/103 (41%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E+ K   +L+GH+  V  +A N    + + S  +D+ +    L  D    G   + +  H
Sbjct: 196 ESTKSVRSLKGHSERVAALAWND---NTLTSGGKDEVI----LHHDLRAPGCCAEMMKVH 248

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              I  +          SG  D  L +WD  + +   +FE+HT
Sbjct: 249 EQEICGLQWDRSLGQLASGGNDNNLFVWDYRSSRPLHKFEEHT 291



 Score = 29.1 bits (62), Expect = 0.55
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L  H++ +  + +S DG   ++G+ D+TLR W L
Sbjct: 375 LTAHTNRVLYLSMSPDGQSIVTGAGDETLRFWKL 408


>SPAC144.13c |srw1|ste9|CDK inhibitor Srw1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 556

 Score = 31.1 bits (67), Expect = 0.14
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           GTL+GH   V  +A +P   + I++ + D+TL  WKL
Sbjct: 498 GTLKGHTDRVLYLAMSPN-GENIVTGAADETLRFWKL 533



 Score = 29.9 bits (64), Expect = 0.31
 Identities = 13/39 (33%), Positives = 23/39 (58%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           L GH+  +  + +S +G   ++G+ D+TLR W L   K+
Sbjct: 500 LKGHTDRVLYLAMSPNGENIVTGAADETLRFWKLFDSKS 538



 Score = 28.3 bits (60), Expect = 0.96
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 4/58 (6%)
 Frame = +2

Query: 197 GIPQKRLYGHSHFISDVVLS----SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GI  +    H+ + +D V S      G +   G+ + ++ +WD A  K TR    HT+
Sbjct: 277 GISSEVTVMHNFYPTDTVTSLRWVQRGTHLAVGTHNGSVEIWDAATCKKTRTMSGHTE 334


>SPAC23H3.08c |bub3||mitotic spindle checkpoint protein
           Bub3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 320

 Score = 30.7 bits (66), Expect = 0.18
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKR---LYGHSHFISDVVLSSDGNYALSGSWD 292
           P + L  + +KT +V  L        +  +    L  H   +S +      N  +SGSWD
Sbjct: 57  PILSLEYTDEKTALVGNLDGTVTTLDLNTRNHEFLGNHGKGVSCISKLRLENCFISGSWD 116

Query: 293 KTLRLWDL 316
           K+ R+WD+
Sbjct: 117 KSFRVWDV 124


>SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1323

 Score = 30.7 bits (66), Expect = 0.18
 Identities = 24/101 (23%), Positives = 43/101 (42%), Gaps = 4/101 (3%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   VT +  + + PD++ + S D ++  W L         P    Y   +  + V 
Sbjct: 318 LHGHTRAVTDMNWHRQNPDVLATCSIDSSVHCWDLRSPR----FPVNSFYDWHNGATQVK 373

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK----TTRRFEDHTKV 361
            +    + L+ S  + +R+WD   G     T +  E+ TK+
Sbjct: 374 WNYKNPHILASSHGRLVRIWDDRYGSAPLHTIKTSENITKI 414


>SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 713

 Score = 30.7 bits (66), Expect = 0.18
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +2

Query: 203 PQKRLYGH-SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           P   L+GH S+  S   L+S+    ++GSWD T R+W L   K
Sbjct: 90  PSYYLFGHESNICSASALNSET--IITGSWDSTARVWALGQCK 130



 Score = 26.6 bits (56), Expect = 2.9
 Identities = 22/85 (25%), Positives = 36/85 (42%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL  ++  HN  V  +    + P    S S D  + +W  T D    G     L+GH+ F
Sbjct: 167 KLVKSILAHNDCVRSLC---QIPGGFASCSNDGVIKLW--TSD----GEFLYELHGHTSF 217

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLW 310
           +  +    +     S   D+T+R+W
Sbjct: 218 VYSLTYIHNQQLIASCGEDRTIRIW 242


>SPBC1A4.07c |||U3 snoRNP-associated protein
           Sof1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 436

 Score = 30.7 bits (66), Expect = 0.18
 Identities = 21/79 (26%), Positives = 35/79 (44%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           + H   V  +  +P   + + S S DKT+ ++ +    +      KR+      ++ V  
Sbjct: 270 KDHVSAVMSVDFSPTGQEFV-SGSYDKTIRIYNVREGHSRDVYHTKRMQR----VTAVKF 324

Query: 254 SSDGNYALSGSWDKTLRLW 310
           S D  Y  SGS D  +RLW
Sbjct: 325 SMDAQYIFSGSDDSNVRLW 343



 Score = 29.1 bits (62), Expect = 0.55
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H   +  V  S  G   +SGS+DKT+R++++  G +  R   HTK
Sbjct: 272 HVSAVMSVDFSPTGQEFVSGSYDKTIRIYNVREGHS--RDVYHTK 314


>SPBC18H10.06c |swd2|swd2.1|COMPASS complex subunit
           Swd2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 357

 Score = 30.7 bits (66), Expect = 0.18
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH   ++ + +S      LS S D T+RLWDL
Sbjct: 110 GHKQTVTSIDVSPADETFLSASLDNTIRLWDL 141


>SPAC959.03c |||U3 snoRNP-associated protein
           Utp7|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 520

 Score = 30.7 bits (66), Expect = 0.18
 Identities = 12/42 (28%), Positives = 22/42 (52%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           P  ++  H   + D+ ++ DG Y ++   D  L++WDL   K
Sbjct: 257 PLVKMLTHRGPVRDLAVNRDGRYMVTAGADSLLKVWDLRTYK 298


>SPAC824.04 |||WD repeat protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 341

 Score = 30.3 bits (65), Expect = 0.24
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           GH   V+ I  +P   D  +S++ DKTL +WK+ +     G
Sbjct: 106 GHTDIVSSIEVSP-IEDQFVSTANDKTLKLWKMNQSSRCLG 145



 Score = 27.1 bits (57), Expect = 2.2
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  +S + +S   +  +S + DKTL+LW +
Sbjct: 106 GHTDIVSSIEVSPIEDQFVSTANDKTLKLWKM 137


>SPAC2E1P5.05 |||U3 snoRNP-associated protein Rrp9
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 524

 Score = 30.3 bits (65), Expect = 0.24
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           N   SGSWD  +RLW +A G   R FE  T
Sbjct: 424 NLFASGSWDGNIRLWKIAEG--LRSFEPLT 451



 Score = 29.5 bits (63), Expect = 0.42
 Identities = 26/91 (28%), Positives = 41/91 (45%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S TL+ +   + H   V  +A      +M  S S D+++ VW L  D+ +Y    + L+G
Sbjct: 237 SVTLEPQHCWKHHRDAVMGLAMRRGTNEMF-SCSADRSIKVWSL--DQMSY---IETLFG 290

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           H   I  V   +       G  D+T RLW +
Sbjct: 291 HQDVIFGVDALARERCVSVGGRDRTSRLWKI 321


>SPAC23H3.05c |swd1||COMPASS complex subunit
           Swd1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 398

 Score = 30.3 bits (65), Expect = 0.24
 Identities = 27/102 (26%), Positives = 45/102 (44%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           L  PFS       L  TL+  +    + +TN  +   + S   + ++++W L+     + 
Sbjct: 5   LLDPFSIPDYPEALTTTLKHGHATSIRFSTNGYH---LASGLVNGSVVIWDLS----TFS 57

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           +  + L GH+  I  V  SS   + L+ S D    LWDL  G
Sbjct: 58  V-SRVLTGHTRAIQSVCWSSCDRFLLTASRDWKCILWDLRDG 98



 Score = 27.5 bits (58), Expect = 1.7
 Identities = 14/49 (28%), Positives = 26/49 (53%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QN 370
           H H  S +  S++G +  SG  + ++ +WDL+    +R    HT+  Q+
Sbjct: 24  HGHATS-IRFSTNGYHLASGLVNGSVVIWDLSTFSVSRVLTGHTRAIQS 71


>SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 807

 Score = 29.9 bits (64), Expect = 0.31
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           K + GH  F+  +     G +  S S+D TL++W L+
Sbjct: 178 KVIEGHHTFVGGLAFDPMGQFLASQSFDHTLKVWKLS 214


>SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1224

 Score = 28.3 bits (60), Expect = 0.96
 Identities = 13/46 (28%), Positives = 22/46 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           L GH      ++  P+ P  +LSS +D   +VW +   E+    P+
Sbjct: 256 LTGHQKAALSLSWCPEDPTFLLSSGKDGRAMVWNVETGESLGSFPR 301


>SPAC227.07c |pab1||protein phosphatase regulatory subunit
           Pab1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 463

 Score = 27.9 bits (59), Expect = 1.3
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ISDV  S +G Y LS  +  TL++WD+
Sbjct: 287 ISDVKFSQNGRYILSRDY-LTLKIWDV 312


>SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 488

 Score = 27.9 bits (59), Expect = 1.3
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L GHS  +  +   SDG    SG  D  +++WD
Sbjct: 300 LQGHSSEVCGLAWRSDGLQLASGGNDNVVQIWD 332


>SPBC4F6.13c |||WD repeat/BOP1NT protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 736

 Score = 27.9 bits (59), Expect = 1.3
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           GH   +  + +   GN+  SG  D  LR+W++  G+
Sbjct: 377 GHKGRVRCLSVHVSGNWLASGGDDGVLRIWEVMTGR 412


>SPBC21.05c |ral2||Ras guanyl-nucleotide exchange factor Ral2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 611

 Score = 27.5 bits (58), Expect = 1.7
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +2

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           DE +  +     YGH H + D  L       LS S+ + + ++DL +GK
Sbjct: 153 DEKSKHLYPSARYGHLHCVLDHYLIIFCGQDLSNSYIEEINIFDLDSGK 201


>SPCC18.13 |||tRNA |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 421

 Score = 26.2 bits (55), Expect = 3.9
 Identities = 17/45 (37%), Positives = 21/45 (46%)
 Frame = +2

Query: 179 RDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           RD  N    +   YG +  I  V  S D +   + S DK LRLWD
Sbjct: 48  RDNINEKHREAAAYGEA--IRQVAFSKDYSRMATVSEDKCLRLWD 90


>SPCC1827.08c |pof7|SPCC70.11c|F-box protein
           Pof7|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 361

 Score = 26.2 bits (55), Expect = 3.9
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 4/54 (7%)
 Frame = +2

Query: 149 DKTLIVWKLTRDEN----NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKT 298
           + T IV++ + + N    N+ +    L+     +S   + S+GN AL+GSW  T
Sbjct: 239 NSTCIVYQSSNEPNDVVRNFSVQNTSLFSP---MSSSPMFSNGNVALTGSWSMT 289


>SPBC17D11.08 |||WD repeat protein, human WDR68
           family|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 435

 Score = 26.2 bits (55), Expect = 3.9
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 13/102 (12%)
 Frame = +2

Query: 92  VTQIATNPKY----PDMILSSSRDKTLIVWKLTRDENNYGIP---QKRLYGHSHFISDVV 250
           VT++  NP       D  L +S D+ L +WK T  E     P   Q  L  H    ++  
Sbjct: 110 VTKLLWNPSSVGSNTDSQLLASTDQQLRLWK-TDFEAGIDSPLLCQASLSTHVKTHNNAP 168

Query: 251 LSS------DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           L+S      D +Y +  S D T  +WD+ A ++  +   H K
Sbjct: 169 LTSFDWCKTDPSYIVVSSLDTTCTVWDIVAQQSKTQLIAHDK 210



 Score = 25.0 bits (52), Expect = 9.0
 Identities = 14/52 (26%), Positives = 21/52 (40%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           TLRGH G V  +   P     + +   D  + +W L +  N    P   + G
Sbjct: 310 TLRGHKGDVNAVKWMPGSKSKLATCGDDCVVSLWDLDQPVNPSPAPTLSVSG 361


>SPBC119.07 |ppk19||serine/threonine protein kinase
            Ppk19|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1706

 Score = 25.8 bits (54), Expect = 5.1
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +2

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            + VV+S   N+AL G+    L LWDL  G
Sbjct: 1374 TSVVVSEGCNWALIGTTKGWLLLWDLRFG 1402


>SPCC16C4.08c |skb15||Shk1 kinase binding protein
           15|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 341

 Score = 25.8 bits (54), Expect = 5.1
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           I+ + +      AL+   D  LRLWDL  GK
Sbjct: 123 ITGIAVHPSEKLALTVGGDGKLRLWDLVRGK 153


>SPAC12B10.07 |acp1||F-actin capping protein alpha
           subunit|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 256

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 13/48 (27%), Positives = 27/48 (56%), Gaps = 4/48 (8%)
 Frame = +2

Query: 191 NYGIPQKRLYGHS----HFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           NY + +K+L G S    H+  D  +  D +  +S + ++T +L+++ A
Sbjct: 160 NYNVSEKKLEGRSHIRVHYYEDGNVWLDASRPISATVEETSKLYEVLA 207


>SPAC25H1.06 |||histone acetyltransferase complex subunit
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 408

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWK 172
           GH G V ++  +P     I S + D  L +WK
Sbjct: 371 GHKGTVNEVDFDPFEAQCIASVADDNELHIWK 402


>SPBC2A9.03 |||conserved protein |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 426

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%)
 Frame = +2

Query: 260 DGNYALSGSWDKTLRLWDL-AAGKTTR 337
           +GN   +G  D T ++WD+ A GK+ R
Sbjct: 311 NGNILATGGQDTTAKVWDIRALGKSFR 337


>SPCC63.06 |||human WDR89 family WD repeat
           protein|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 331

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 13/50 (26%), Positives = 27/50 (54%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN 193
           SE   +R     HN  +T +  +PK  +++L+ S D  + +   T++E++
Sbjct: 133 SEQKLIRQWNDAHNDDITHLQFHPKDNELLLTGSVDGLVSLLDTTKEEDS 182


>SPCC613.12c |raf1|dos1, cmc1, clr8|Rik1-associated factor
           Raf1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 638

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 8/27 (29%), Positives = 17/27 (62%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ISD+  S    +  +G++D  +++WD+
Sbjct: 302 ISDLCFSKGNLFLYTGAFDNAVKVWDM 328


>SPAC7D4.09c |||steroid dehydrogenase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 274

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -2

Query: 446 WSSASHRHLGLSSVHNQHL 390
           W +ASH HL     H+Q+L
Sbjct: 182 WQNASHEHLIAQKNHSQYL 200


>SPBP35G2.03c |sgo1||shugoshin Sgo1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 319

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%)
 Frame = +2

Query: 146 RDKTLI-VWKLTRDENNYGIPQKRL 217
           +DKT   V K+ +DE NY +PQK +
Sbjct: 186 KDKTNAHVNKIPQDEVNYSLPQKNI 210


>SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 800

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 12/45 (26%), Positives = 24/45 (53%)
 Frame = +2

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           D +N     + L+ H++ ++ +  + +G Y LSG  +  L LW +
Sbjct: 247 DISNEKFNPQILHWHANPLNGLSWALNGEYLLSGGQEGVLVLWQM 291


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,515,603
Number of Sequences: 5004
Number of extensions: 50941
Number of successful extensions: 407
Number of sequences better than 10.0: 87
Number of HSP's better than 10.0 without gapping: 207
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 360
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 277683324
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -