SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A08
         (614 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC29B5.02c |isp4||OPT oligopeptide transporter family |Schizos...    26   3.8  
SPBC20F10.02c |||DUF1741 family protein|Schizosaccharomyces pomb...    26   5.0  
SPAC664.15 |||CCR4-Not complex subunit Caf4/Mdv1 |Schizosaccharo...    26   5.0  
SPBC13G1.05 |||DUF747 family protein|Schizosaccharomyces pombe|c...    25   8.7  
SPAC16E8.06c |nop12||RNA-binding protein Nop12|Schizosaccharomyc...    25   8.7  
SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces...    25   8.7  

>SPBC29B5.02c |isp4||OPT oligopeptide transporter family
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 785

 Score = 26.2 bits (55), Expect = 3.8
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = +3

Query: 234 FGESINKTVKKDKDADNLLDQYEDYEP 314
           FG S N T    KDA   LD Y++Y P
Sbjct: 379 FGNSYNVTRILTKDATFDLDAYQNYSP 405


>SPBC20F10.02c |||DUF1741 family protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 600

 Score = 25.8 bits (54), Expect = 5.0
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +3

Query: 6   CCLITLKVFXTNVTVCQLFICFSFIDRVRTSLLR 107
           CC+        N++    F+ FSF+ R  TSL++
Sbjct: 397 CCIGIQHNMKLNLSATMYFLYFSFVYRAMTSLVQ 430


>SPAC664.15 |||CCR4-Not complex subunit Caf4/Mdv1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 651

 Score = 25.8 bits (54), Expect = 5.0
 Identities = 15/37 (40%), Positives = 19/37 (51%)
 Frame = -2

Query: 151 SHSITVTLDFWNLALRSSDVLTRSMKEKQMKSWHTVT 41
           SH+  VT     LAL S DVL     +K ++ W  VT
Sbjct: 433 SHTAPVTA----LALSSDDVLITGADDKTVRQWDIVT 465


>SPBC13G1.05 |||DUF747 family protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 649

 Score = 25.0 bits (52), Expect = 8.7
 Identities = 13/23 (56%), Positives = 15/23 (65%)
 Frame = -1

Query: 470 FSTTRSRISSPNFCVPISRKLHL 402
           FST   R SSPN  +P SRK+ L
Sbjct: 204 FSTFFHRNSSPNRSLPRSRKIDL 226


>SPAC16E8.06c |nop12||RNA-binding protein Nop12|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 438

 Score = 25.0 bits (52), Expect = 8.7
 Identities = 15/35 (42%), Positives = 21/35 (60%)
 Frame = +3

Query: 261 KKDKDADNLLDQYEDYEPAEYQEVLYNEDRPCPRD 365
           +KDKD+  L++  ED  PA+ Q VL  E+R    D
Sbjct: 113 EKDKDSAGLINDEEDKSPAK-QSVL--EERTSQED 144


>SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 3131

 Score = 25.0 bits (52), Expect = 8.7
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -1

Query: 410  LHLACLYPLRYRAYAVSG 357
            L LACLYPLR R  +  G
Sbjct: 1902 LDLACLYPLRIRPVSKLG 1919


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,373,273
Number of Sequences: 5004
Number of extensions: 46104
Number of successful extensions: 125
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 123
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 125
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 269634532
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -