SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A06
         (414 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC18E5.06 |rps21||40S ribosomal protein S21|Schizosaccharomyce...    56   2e-09
SPBC25H2.02 |ths1||threonine-tRNA ligase Ths1 |Schizosaccharomyc...    25   3.5  
SPAC17G8.06c |||dihydroxy-acid dehydratase|Schizosaccharomyces p...    25   6.1  
SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces...    24   8.1  
SPBC1683.09c |frp1||ferric-chelate reductase Frp1|Schizosaccharo...    24   8.1  

>SPBC18E5.06 |rps21||40S ribosomal protein S21|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 87

 Score = 56.4 bits (130), Expect = 2e-09
 Identities = 23/31 (74%), Positives = 28/31 (90%)
 Frame = +1

Query: 49  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 141
           M+N+AG+ VDLY PRKCSA+NR+I AKDHAS
Sbjct: 1   MENEAGQLVDLYVPRKCSATNRIIQAKDHAS 31



 Score = 41.9 bits (94), Expect = 4e-05
 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +2

Query: 146 QLVIADVDPATGRAADTSKM-YVVCGAIRRMGESDDCIVRLTKKDGIL 286
           Q+ +  VD A GR     K  Y + G +R  GESDDCI RLT +DG+L
Sbjct: 33  QINVCAVD-AEGRQIPGEKTTYAISGFVRSKGESDDCINRLTTQDGLL 79


>SPBC25H2.02 |ths1||threonine-tRNA ligase Ths1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 703

 Score = 25.4 bits (53), Expect = 3.5
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = -2

Query: 131 SLAWMRRLLAEHFLGQYKSTNSPASFCILYV 39
           SL  M  +L EH+ G++    SP   CI+ V
Sbjct: 575 SLERMIAILTEHYAGKWPFWMSPRQVCIIPV 605


>SPAC17G8.06c |||dihydroxy-acid dehydratase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 598

 Score = 24.6 bits (51), Expect = 6.1
 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 2/26 (7%)
 Frame = -3

Query: 226 DSPT--DNIHFRCVSSTTCGGVYVSN 155
           D PT  D I   C     CGG+Y +N
Sbjct: 214 DEPTRHDIIRHACPGGGACGGMYTAN 239


>SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1639

 Score = 24.2 bits (50), Expect = 8.1
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -1

Query: 90  RAVQVNEFTGVVLHFICTST 31
           RAV + + TG VLHF  T T
Sbjct: 808 RAVPLRDCTGSVLHFFGTMT 827


>SPBC1683.09c |frp1||ferric-chelate reductase
           Frp1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 564

 Score = 24.2 bits (50), Expect = 8.1
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = -3

Query: 172 GVYVSNH*LXLKHGP*RG*GGCWPSISSGSTSQRIHRRRSAFYMYVHTVHG 20
           G+YV+++   +K+ P          ISS      +HRR S + + +  +HG
Sbjct: 127 GLYVTSYFFSIKNNP-----FALLLISSHEKMNYVHRRLSQYAIMIGAIHG 172


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,388,472
Number of Sequences: 5004
Number of extensions: 23797
Number of successful extensions: 63
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 61
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 144287194
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -