SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A04
         (587 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC660.15 |||mRNA cleavage factor complex subunit |Schizosaccha...   119   3e-28
SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M...    78   8e-16
SPBC4F6.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr ...    52   8e-08
SPAC16E8.06c |nop12||RNA-binding protein Nop12|Schizosaccharomyc...    50   2e-07
SPBC365.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr...    48   1e-06
SPBC887.05c |cwf29||RNA-binding protein Cwf29|Schizosaccharomyce...    47   2e-06
SPBC16E9.12c |pab2||poly|Schizosaccharomyces pombe|chr 2|||Manual      46   3e-06
SPAC22E12.02 |||RNA-binding protein|Schizosaccharomyces pombe|ch...    46   3e-06
SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces...    46   5e-06
SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyce...    45   7e-06
SPAC19A8.13 |usp101|snp1|U1 snRNP-associated protein Usp101 |Sch...    44   1e-05
SPBC18H10.03 |tif35||translation initiation factor eIF3g|Schizos...    44   2e-05
SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra...    43   4e-05
SPAC57A7.04c |pabp||mRNA export shuttling protein |Schizosacchar...    43   4e-05
SPCC1827.05c |||nucleolar RNA-binding protein NIFK |Schizosaccha...    42   5e-05
SPAC328.05 |||RNA-binding protein involved in export of mRNAs|Sc...    39   5e-04
SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr ...    38   8e-04
SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces p...    38   0.001
SPAC31G5.01 |sap49|SPAPB1A11.05|RNA-binding protein Sap49|Schizo...    37   0.002
SPBC3B9.11c |ctf1||mRNA cleavage and polyadenylation specificity...    36   0.003
SPBC29A10.02 |spo5|mrb1, mug12, SPBC365.18|meiotic RNA-binding p...    36   0.003
SPAC16.02c |srp2||mRNA export factor Srp2|Schizosaccharomyces po...    36   0.004
SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos...    35   0.008
SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce...    35   0.010
SPAC343.07 |mug28||RNA-binding protein Mug28|Schizosaccharomyces...    34   0.013
SPBC18H10.04c |sce3|tif48|translation initiation factor eIF4B|Sc...    34   0.013
SPBP16F5.06 |||ribosome biogenesis protein Nop6|Schizosaccharomy...    33   0.031
SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||...    33   0.041
SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyc...    31   0.12 
SPBC8D2.09c |||U2 snRNP-associated protein Msl1 |Schizosaccharom...    30   0.29 
SPBC13A2.01c |||nuclear cap-binding complex small subunit|Schizo...    29   0.50 
SPCC4B3.06c |||NADPH-dependent FMN reductase |Schizosaccharomyce...    28   1.2  
SPBC660.11 |tcg1|mug187|single-stranded telomeric binding protei...    27   1.5  
SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosa...    27   2.0  
SPAC31A2.09c |apm4||AP-2 adaptor complex subunit Apm4 |Schizosac...    26   4.7  
SPBC29A3.07c |||U2 snRNP-associated protein Sf3b14 homolog |Schi...    26   4.7  
SPCC1223.06 |tea1|alp8|cell end marker Tea1|Schizosaccharomyces ...    26   4.7  
SPAC16C9.04c |||CCR4-Not complex subunit Mot2 |Schizosaccharomyc...    26   4.7  
SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces ...    25   6.2  
SPBC1D7.04 |mlo3||RNA annealing factor Mlo3|Schizosaccharomyces ...    25   6.2  
SPBC119.16c |||conserved fungal protein|Schizosaccharomyces pomb...    25   8.2  

>SPBC660.15 |||mRNA cleavage factor complex subunit
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 474

 Score =  119 bits (287), Expect = 3e-28
 Identities = 55/113 (48%), Positives = 78/113 (69%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E GK+F+GGL+WET+ ++L+ YF ++GEV+DC VM++S +GRSRGFGF+TF +P  VN V
Sbjct: 161 EDGKMFIGGLNWETTDDSLRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEV 220

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +    H LDG+ IDPK   PR  Q+        K+F+GG+P + TE + R  F
Sbjct: 221 MSK-EHHLDGKIIDPKRAIPREEQEKT-----AKMFVGGVPGDCTEEEFRNFF 267



 Score = 67.7 bits (158), Expect = 1e-12
 Identities = 27/90 (30%), Positives = 53/90 (58%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P  + ++  K+FVGG+  + ++E  + +F+++G V+D  +M + ++GR RGFGFVT+
Sbjct: 236 RAIPREEQEKTAKMFVGGVPGDCTEEEFRNFFNQFGRVLDATLMMDKDTGRPRGFGFVTY 295

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPR 322
            + S V   +      + G+ ++ K   P+
Sbjct: 296 ENESAVEATMSQPYITIHGKPVEVKRATPK 325



 Score = 33.9 bits (74), Expect = 0.018
 Identities = 11/33 (33%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF ++G+V++  +M D+   +  G GF+++E+E
Sbjct: 266 FFNQFGRVLDATLMMDKDTGRPRGFGFVTYENE 298


>SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 500

 Score = 78.2 bits (184), Expect = 8e-16
 Identities = 45/132 (34%), Positives = 66/132 (50%), Gaps = 13/132 (9%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  D +E   +FVG LSW    + L + F  YG ++   V+ + +SGRS+G+G+V F  P
Sbjct: 255 PSQDSNETCTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFETP 314

Query: 242 SLVN-LVLQNGPHQLDGRTI-----DPKPCNPRTLQKPKRGG-----GYPK--VFLGGLP 382
                 V  NG  ++DGR +     +P+P NP+   + + G        P   VF+G L 
Sbjct: 315 EAAKAAVAANGTKEIDGRMVNLDLSNPRPANPQPYAQQRAGNFGDQLSEPSDTVFVGNLS 374

Query: 383 SNVTETDLRXIF 418
            N TE DL   F
Sbjct: 375 FNATEDDLSTAF 386



 Score = 49.6 bits (113), Expect = 3e-07
 Identities = 28/96 (29%), Positives = 47/96 (48%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D   +    +FVG LS+  ++++L   F   G++    +  + +SGR +GFG+VTF+D  
Sbjct: 359 DQLSEPSDTVFVGNLSFNATEDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDID 418

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
                ++   H + GR     PC       P+ GGG
Sbjct: 419 SAKKCVEMNGHFIAGR-----PCR-LDFSTPRTGGG 448


>SPBC4F6.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 674

 Score = 51.6 bits (118), Expect = 8e-08
 Identities = 22/48 (45%), Positives = 34/48 (70%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           LFV  L+++T Q++L  +FS  G +   VV+ N E+G +RG+GFVTF+
Sbjct: 7   LFVRNLAFQTKQDDLTNFFSDVGPIKHAVVVTNPETGENRGYGFVTFS 54


>SPAC16E8.06c |nop12||RNA-binding protein Nop12|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 438

 Score = 50.4 bits (115), Expect = 2e-07
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 4/97 (4%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  D K  +FVG L++E  +E L RYF   G +    ++++ ++   +GF ++ F D   
Sbjct: 264 MPQDTKRCVFVGNLAFEAEEEPLWRYFGDCGSIDYVRIVRDPKTNLGKGFAYIQFKDTMG 323

Query: 248 VN-LVLQNGPHQLDGRTI---DPKPCNPRTLQKPKRG 346
           V+  +L N     +GRT+     K   P+++ + KRG
Sbjct: 324 VDKALLLNEKKMPEGRTLRIMRAKSTKPKSITRSKRG 360


>SPBC365.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 233

 Score = 47.6 bits (108), Expect = 1e-06
 Identities = 23/57 (40%), Positives = 34/57 (59%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           ++D K  LFVG L  ++S E LQ +F R G+V    +  +  SGR +G+ FV F +P
Sbjct: 87  NNDRKVILFVGNLPKDSSVETLQLHFKRAGQVPSVRIPTDKTSGRQKGYAFVEFINP 143


>SPBC887.05c |cwf29||RNA-binding protein Cwf29|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 217

 Score = 47.2 bits (107), Expect = 2e-06
 Identities = 17/66 (25%), Positives = 40/66 (60%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D  +   +++G L ++ +++++   FS +GE +D  ++++ E+G+S+GF F+ + D    
Sbjct: 26  DYSDSAYIYIGNLDFDLNEDDILCVFSEFGEPVDINLVRDKETGKSKGFAFLKYEDQRST 85

Query: 251 NLVLQN 268
            L + N
Sbjct: 86  VLAVDN 91


>SPBC16E9.12c |pab2||poly|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 166

 Score = 46.4 bits (105), Expect = 3e-06
 Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D +  +   ++VG + +  + E LQ +F+  G V    ++ +  +G  +GF ++ F++PS
Sbjct: 48  DKESIDAQSVYVGNVDYSVTPEELQSHFASCGSVNRVTILCDKFTGHPKGFAYIEFSEPS 107

Query: 245 LV-NLVLQNG 271
           LV N +L NG
Sbjct: 108 LVPNALLLNG 117


>SPAC22E12.02 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 219

 Score = 46.4 bits (105), Expect = 3e-06
 Identities = 36/111 (32%), Positives = 55/111 (49%), Gaps = 10/111 (9%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSL 247
           D    +LFVG L  + + E+L + FS Y  ++   V+++ E G++RGFGFV+F  +D  L
Sbjct: 26  DPNHFRLFVGNLGNDVNDESLYQAFSEYPSLVKTKVVRDRE-GKTRGFGFVSFKDSDQFL 84

Query: 248 VNLVLQNG------PHQLDGRTIDPKP--CNPRTLQKPKRGGGYPKVFLGG 376
                +NG      P +L   T D KP   N +T+    R   Y +    G
Sbjct: 85  KAWREKNGKYIGSRPVKLSRATSDVKPNEVNEKTIDSKIRNSLYSRTIHHG 135


>SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 369

 Score = 45.6 bits (103), Expect = 5e-06
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           LFVG L +ET+  +L+ +F + G++    +M   ++G+ +GFGFV F D
Sbjct: 230 LFVGNLDFETTDADLKEHFGQVGQIRRVRLMTFEDTGKCKGFGFVDFPD 278



 Score = 29.5 bits (63), Expect = 0.38
 Identities = 31/115 (26%), Positives = 48/115 (41%), Gaps = 14/115 (12%)
 Frame = +2

Query: 116 ETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRT 295
           E S+EN++   +     I  + M   +  +++GF +V FA    + L LQ     L+GR 
Sbjct: 135 EVSEENIKPITTEQITRIH-MPMSKEKRFQNKGFAYVDFATEDALKLALQCSEKALNGRN 193

Query: 296 I--------DPKPCNP-RTLQKPKRGGGYPK-----VFLGGLPSNVTETDLRXIF 418
           I          +P  P  TL K        K     +F+G L    T+ DL+  F
Sbjct: 194 ILIKSNTDFSGRPSKPANTLSKTASIQSSKKEPSSILFVGNLDFETTDADLKEHF 248



 Score = 25.8 bits (54), Expect = 4.7
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           FG+ G++  V +M  +   K  G GF+ F D
Sbjct: 248 FGQVGQIRRVRLMTFEDTGKCKGFGFVDFPD 278


>SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 297

 Score = 45.2 bits (102), Expect = 7e-06
 Identities = 24/96 (25%), Positives = 45/96 (46%), Gaps = 1/96 (1%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P+  ++    LFV G++    ++ LQ+ FS++G V    +M+   +  SRGFGF++F+  
Sbjct: 93  PEGSENLGNDLFVSGIASRMQEDELQQIFSKFGTVTHVRIMREPVTKASRGFGFLSFSTV 152

Query: 242 SLVNLVLQN-GPHQLDGRTIDPKPCNPRTLQKPKRG 346
                 + N    +  GR ++ +         P  G
Sbjct: 153 EEATSAIDNLNSQEFYGRVLNVQKAKRSRPHSPTPG 188


>SPAC19A8.13 |usp101|snp1|U1 snRNP-associated protein Usp101
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 261

 Score = 44.4 bits (100), Expect = 1e-05
 Identities = 17/47 (36%), Positives = 32/47 (68%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +F+  LS++T + +++R F+RYG +    V++N  +G+S G+ FV F
Sbjct: 102 MFLSRLSYDTKESDIEREFTRYGPIERIRVVRNKVTGKSMGYAFVVF 148


>SPBC18H10.03 |tif35||translation initiation factor
           eIF3g|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 282

 Score = 43.6 bits (98), Expect = 2e-05
 Identities = 20/54 (37%), Positives = 33/54 (61%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           D+   L V  LS +T +E L+  F R+G +    + K+ E+GR++GF FV++ D
Sbjct: 199 DDSATLRVTNLSDDTREEELRDLFRRFGGIQRVYLAKDKETGRAKGFAFVSYYD 252


>SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating
           transcription Rct1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 432

 Score = 42.7 bits (96), Expect = 4e-05
 Identities = 19/47 (40%), Positives = 31/47 (65%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           LFV  L+  T  E+L+  FSR+G++I C V+++ E+G S  + F+ F
Sbjct: 246 LFVCKLNPVTQDEDLELIFSRFGKIISCQVIRDKETGDSLQYAFIEF 292


>SPAC57A7.04c |pabp||mRNA export shuttling protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 653

 Score = 42.7 bits (96), Expect = 4e-05
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN-LVLQN 268
           LF+  L  E   E L+  FS +G +    +M + E G+S+GFGFV +  P   N  V + 
Sbjct: 366 LFIKNLQDEVDDERLKAEFSAFGTITSAKIMTD-EQGKSKGFGFVCYTTPEEANKAVTEM 424

Query: 269 GPHQLDGRTI 298
               L G+ +
Sbjct: 425 NQRMLAGKPL 434



 Score = 33.9 bits (74), Expect = 0.018
 Identities = 13/49 (26%), Positives = 30/49 (61%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +++  L  E +++     F ++GE+    ++K+ ++ + RGFGFV +A+
Sbjct: 263 VYIKNLDTEITEQEFSDLFGQFGEITSLSLVKD-QNDKPRGFGFVNYAN 310


>SPCC1827.05c |||nucleolar RNA-binding protein NIFK
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 276

 Score = 42.3 bits (95), Expect = 5e-05
 Identities = 18/62 (29%), Positives = 37/62 (59%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           +KG L+VG L     ++ ++ YFS++G V+   + +N ++G S+ + F+ F    + N+V
Sbjct: 103 KKGVLYVGRLPHGFYEKQMRMYFSQFGPVLRLRMSRNRKTGSSKHYAFIEFESLDVANVV 162

Query: 260 LQ 265
            +
Sbjct: 163 AE 164


>SPAC328.05 |||RNA-binding protein involved in export of
           mRNAs|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 434

 Score = 39.1 bits (87), Expect = 5e-04
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++VG L W TS  NL   F+  G VI   +     +GRS+GFG V F
Sbjct: 282 IYVGNLPWATSDRNLLDLFTDIGSVIRARI-AYEPTGRSKGFGVVQF 327



 Score = 31.9 bits (69), Expect = 0.071
 Identities = 12/52 (23%), Positives = 31/52 (59%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           ++ +++VG LS++     L+ +  + G V++C ++ N  +G S+G   + ++
Sbjct: 64  QERRVYVGNLSYQVRWFELKEFMGQVGNVLNCEIL-NLPNGLSKGCAIIEYS 114


>SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 422

 Score = 38.3 bits (85), Expect = 8e-04
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 7/99 (7%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG + +E ++E +   F + G V    ++ + ESG+ +G+GF  + DP+     ++N 
Sbjct: 7   VYVGNIPYEMAEEQVIDIFKQSGPVKSFQLVIDPESGQPKGYGFCEYHDPATAASAVRNL 66

Query: 272 PHQLDG----RTIDPKPCNPRTLQK---PKRGGGYPKVF 367
            +   G    R   P     R L K   P R G YP+ +
Sbjct: 67  NNYDAGTRRLRVDFPTADQIRRLDKLLGPSRYGYYPQSY 105


>SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 517

 Score = 37.9 bits (84), Expect = 0.001
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D K K+++  L     ++ +      +G+++   ++KN   G S+GF F  F +PS
Sbjct: 307 DSKDKIYISNLPLNLGEDQVVELLKPFGDLLSFQLIKNIADGSSKGFCFCEFKNPS 362


>SPAC31G5.01 |sap49|SPAPB1A11.05|RNA-binding protein
           Sap49|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 335

 Score = 37.1 bits (82), Expect = 0.002
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           LFVG L     +  L   FS  G+++    +   E+GRS+G+GFV++
Sbjct: 101 LFVGNLDPLVDERVLYDTFSALGQLVKAPQVARDENGRSKGYGFVSY 147


>SPBC3B9.11c |ctf1||mRNA cleavage and polyadenylation specificity
           factor complex subunit Ctf1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 363

 Score = 36.3 bits (80), Expect = 0.003
 Identities = 14/49 (28%), Positives = 29/49 (59%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FVG + ++ S++ +   F++ G V    ++ + E+G  +G+GF  F D
Sbjct: 9   VFVGNIPYDVSEQQMTEIFNQVGPVKTFKLVLDPETGSGKGYGFCEFFD 57


>SPBC29A10.02 |spo5|mrb1, mug12, SPBC365.18|meiotic RNA-binding
           protein 1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 567

 Score = 36.3 bits (80), Expect = 0.003
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +++ GL   TS ENL  Y +R+G+V     + + E+   +G+GF  F +
Sbjct: 298 VYIRGLPPNTSDENLLLYTNRFGKVSSSKAIIDMETNLCKGYGFACFEE 346



 Score = 25.8 bits (54), Expect = 4.7
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+GKV     + D       G GF  FE+E S
Sbjct: 315 YTNRFGKVSSSKAIIDMETNLCKGYGFACFEEEKS 349


>SPAC16.02c |srp2||mRNA export factor Srp2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 365

 Score = 35.9 bits (79), Expect = 0.004
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +LFVG +  + ++E++  +F  YG+++DC +M         GFGFV   D
Sbjct: 5   RLFVGRIPPQATREDMMDFFKGYGQILDCKLM--------NGFGFVEVED 46


>SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm
           type|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 473

 Score = 35.1 bits (77), Expect = 0.008
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYF-SRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FVG LS   ++ ++   F SRY       +M + ++  SRG+GFV F D
Sbjct: 188 IFVGDLSPNVNEFDVYSLFASRYNSCKSAKIMTDPQTNVSRGYGFVRFTD 237



 Score = 33.5 bits (73), Expect = 0.023
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           P   D     +FVGGLS   S+E L+  F  +GE++   +         +G GFV F +
Sbjct: 295 PQFADTANSTVFVGGLSKFVSEEELKYLFQNFGEIVYVKIPP------GKGCGFVQFVN 347



 Score = 26.6 bits (56), Expect = 2.7
 Identities = 13/33 (39%), Positives = 14/33 (42%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  RY       IM D     S G GF+ F DE
Sbjct: 206 FASRYNSCKSAKIMTDPQTNVSRGYGFVRFTDE 238


>SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 604

 Score = 34.7 bits (76), Expect = 0.010
 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVLQ 265
           +L V  + +  + E+++  F  +G+ I+ V ++  +  RS+GFG++ + +P S  N + +
Sbjct: 341 RLCVSNIHFNLTDEDVKAIFEPFGD-IEFVHLQRDDQNRSKGFGYIQYRNPISARNALEK 399

Query: 266 NGPHQLDGRTI 298
                L GR +
Sbjct: 400 MNGFDLAGRNM 410



 Score = 34.3 bits (75), Expect = 0.013
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           ++ ++  +FV  L+   +   L  +F + G V D  ++++  SGRS+G  +V F     V
Sbjct: 235 EERDRRTVFVSQLANRLTSRELYDFFEQAGPVRDAQIVRDKISGRSKGVAYVEFCHEDSV 294

Query: 251 NLVL 262
              +
Sbjct: 295 QAAI 298


>SPAC343.07 |mug28||RNA-binding protein Mug28|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 609

 Score = 34.3 bits (75), Expect = 0.013
 Identities = 12/38 (31%), Positives = 23/38 (60%)
 Frame = +2

Query: 128 ENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           + L+  FS++G +  C +     +  S+G+GFV+F+ P
Sbjct: 435 QQLEELFSKFGRIKSCTLASYPSTEISKGYGFVSFSHP 472


>SPBC18H10.04c |sce3|tif48|translation initiation factor
           eIF4B|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 388

 Score = 34.3 bits (75), Expect = 0.013
 Identities = 23/75 (30%), Positives = 35/75 (46%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPH 277
           VG LS++ ++ +L  +F      I  V+   +E  RSRGFG+V F     ++  L     
Sbjct: 98  VGNLSFDLTENDLGDFFGEGVTSIRLVIDPLTE--RSRGFGYVEFETADTLSAALALSGE 155

Query: 278 QLDGRTIDPKPCNPR 322
            L GR +      PR
Sbjct: 156 DLMGRPVRITVAEPR 170


>SPBP16F5.06 |||ribosome biogenesis protein Nop6|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 478

 Score = 33.1 bits (72), Expect = 0.031
 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDC-VVMKNSESGRSRGFGFVTF 232
           +++VGGLS      +L+  FSR+G V +  ++ K++  G  + F ++ F
Sbjct: 6   RIYVGGLSSSIESSDLESRFSRFGSVSNLEIINKSTPVGTIQRFAYLNF 54


>SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 710

 Score = 32.7 bits (71), Expect = 0.041
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEV 166
           P   +DE   ++VG +    S E + ++FS+YG+V
Sbjct: 9   PGQYEDESSTIYVGNIDSRLSDEEIIKHFSKYGQV 43



 Score = 31.5 bits (68), Expect = 0.094
 Identities = 13/38 (34%), Positives = 22/38 (57%)
 Frame = +2

Query: 119 TSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           T +  L+  FS +G ++  ++     SG S+G+GFV F
Sbjct: 395 TCKSQLEDLFSPFGSILSSMLACYPNSGISKGYGFVAF 432


>SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 529

 Score = 31.1 bits (67), Expect = 0.12
 Identities = 26/94 (27%), Positives = 40/94 (42%), Gaps = 11/94 (11%)
 Frame = +2

Query: 161 EVIDCVVMKNSESG---RSRGFGFVTFADPSLVNLVLQNGP-HQLDGRTIDPK------- 307
           E++ CV     ES      +   F++F DPS      Q+    +L  R  + K       
Sbjct: 130 EILSCVRTGPIESAWILPEKNCAFISFLDPSHATAFFQDAALKRLTIRGTEVKVGWGKNS 189

Query: 308 PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLR 409
             N   L   ++ G    VFLG LP+ +TE ++R
Sbjct: 190 ASNSSVLLAVQQSGACRNVFLGNLPNGITEDEIR 223


>SPBC8D2.09c |||U2 snRNP-associated protein Msl1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 111

 Score = 29.9 bits (64), Expect = 0.29
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +2

Query: 134 LQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           L   FS YG V+D V +K   + + RG   V F DPS   + ++
Sbjct: 24  LYMLFSTYGTVVDIVALK---TPKMRGQAHVVFFDPSAAAIAMK 64


>SPBC13A2.01c |||nuclear cap-binding complex small
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 182

 Score = 29.1 bits (62), Expect = 0.50
 Identities = 14/47 (29%), Positives = 27/47 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++VG LS+ T++E +   FS+ GE+   ++  +  +    GF FV +
Sbjct: 34  VYVGNLSFYTTEEQIYALFSKCGEIRRIIMGVDRFTKTPCGFCFVEY 80


>SPCC4B3.06c |||NADPH-dependent FMN reductase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 200

 Score = 27.9 bits (59), Expect = 1.2
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +2

Query: 335 PKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGHGGGHYV*SXEEKVXGF 487
           P+  GGYP +    L     E + + +    + GHGGG    S  + V GF
Sbjct: 95  PQYNGGYPAILKNALDHLYHEWNGKPLLIVSYGGHGGGDCA-SQLKHVAGF 144


>SPBC660.11 |tcg1|mug187|single-stranded telomeric binding protein
           Tgc1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 348

 Score = 27.5 bits (58), Expect = 1.5
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 12/61 (19%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKN------------SESGRSRGFGFVTFA 235
           ++V GLS   + E L+  F  Y      + +++             E  R RGFGFV+FA
Sbjct: 207 IYVSGLSVTLTNEGLKEMFDAYNPTRARIAVRSLPPYIIRRIKLRGEQRRGRGFGFVSFA 266

Query: 236 D 238
           +
Sbjct: 267 N 267


>SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein
           Msa1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 533

 Score = 27.1 bits (57), Expect = 2.0
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 146 FSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           FS+YG+VIDC ++  S   +   F F+ F
Sbjct: 386 FSKYGKVIDCKIIHQS---KKPAFAFLRF 411


>SPAC31A2.09c |apm4||AP-2 adaptor complex subunit Apm4
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 446

 Score = 25.8 bits (54), Expect = 4.7
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%)
 Frame = +1

Query: 307 AVQSSHSSKTE--TWRWIP*GVPWRAAIERYRNRS 405
           +++ SHSS+    T   IP  VPWR A  +YR  S
Sbjct: 145 SLKRSHSSQLAHTTSSEIPGSVPWRRAGIKYRKNS 179


>SPBC29A3.07c |||U2 snRNP-associated protein Sf3b14 homolog
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 137

 Score = 25.8 bits (54), Expect = 4.7
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           LF+  LS++ + E +   F RYG V     ++   + ++RG  FV +
Sbjct: 14  LFIKNLSFKITAEEMYDLFGRYGPVRQ---IRLGNTVQTRGTAFVVY 57


>SPCC1223.06 |tea1|alp8|cell end marker Tea1|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1147

 Score = 25.8 bits (54), Expect = 4.7
 Identities = 23/88 (26%), Positives = 34/88 (38%), Gaps = 4/88 (4%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFV---GGLSWETSQENLQRYFSRYGEVIDCVVMKNS-ESGRSRGFGFV 226
           N D+ D +   L++     L W+ +  +  R   RYG  I C+  K     GR   + F 
Sbjct: 154 NHDVADRQDNSLYLLNTSSLVWQKANASGARPSGRYGHTISCLGSKICLFGGRLLDYYFN 213

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKP 310
                 L NL   +   +L     DP P
Sbjct: 214 DLVCFDLNNLNTSDSRWELASVVNDPPP 241


>SPAC16C9.04c |||CCR4-Not complex subunit Mot2 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 489

 Score = 25.8 bits (54), Expect = 4.7
 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 6/51 (11%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETS-QENLQ-----RYFSRYGEVIDCVVMKNSESGRSRG 214
           +K   +V GLS + + +EN+       YF +YG++I   + K + +  + G
Sbjct: 114 QKNLAYVNGLSPKVANEENINVLKGPEYFGQYGKIIKIAINKKAAANSANG 164


>SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 620

 Score = 25.4 bits (53), Expect = 6.2
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG 202
           LF+GG++    +  L+  F R+G V   ++  N   G
Sbjct: 408 LFLGGITRSVREPVLRSMFERFGSVQSLILNHNYRHG 444


>SPBC1D7.04 |mlo3||RNA annealing factor Mlo3|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 199

 Score = 25.4 bits (53), Expect = 6.2
 Identities = 16/74 (21%), Positives = 32/74 (43%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+ V  L  + ++  ++  F +       V +    +GRS+G   + F+ P      
Sbjct: 53  EESKIIVSNLPTDVTEAQVKELFVKSIGPCKRVSLAYGPNGRSKGIATIIFSRPGDATRA 112

Query: 260 LQNGPHQLDGRTID 301
            +    Q +GR +D
Sbjct: 113 YE----QYEGRLVD 122


>SPBC119.16c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 448

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +2

Query: 116 ETSQENLQRYFSRYGEVIDCVVMKNSES 199
           E   EN+  YF RY + +  V+  N+ES
Sbjct: 356 EFLNENMLDYFQRYNQKLLTVLSSNAES 383


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,318,408
Number of Sequences: 5004
Number of extensions: 46841
Number of successful extensions: 167
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 138
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 163
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 254167452
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -