BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_E24 (649 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A2.01 |bsu1|SPAC1B1.05, bsu1|high-affinity import carrier ... 26 5.4 SPAC4G8.12c |||alpha-1,2-mannosyltransferase |Schizosaccharomyce... 25 7.1 SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharom... 25 7.1 >SPAC17A2.01 |bsu1|SPAC1B1.05, bsu1|high-affinity import carrier for pyridoxine, pyridoxal, and pyridoxamine Bsu1|Schizosaccharomyces pombe|chr 1|||Manual Length = 526 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 474 VPKNNNMALFYEYFTITTIINYLYLYNPMIILSSIINFY 590 +PKNN + + +TT+ + L P+I+ + NFY Sbjct: 280 IPKNNLKEVLKKCKFVTTMGFRMMLTEPIILSMGLYNFY 318 >SPAC4G8.12c |||alpha-1,2-mannosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 25.4 bits (53), Expect = 7.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 34 NEDDPATYYFYKVYNGP 84 N + P T YF+K+Y+ P Sbjct: 390 NPEMPTTIYFWKIYSAP 406 >SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharomyces pombe|chr 1|||Manual Length = 706 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = -3 Query: 281 YNLFMLFSAVTSDKLSREFRYRLR 210 +N +LFS++T SR ++YR++ Sbjct: 163 FNSSILFSSITKINFSRGYKYRIQ 186 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,268,755 Number of Sequences: 5004 Number of extensions: 40348 Number of successful extensions: 73 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -