BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov2p23 (399 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP23A10.05 |ssr4||SWI/SNF and RSC complex subunit Ssr4|Schizos... 27 1.4 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 27 1.4 SPCC1840.04 |||caspase|Schizosaccharomyces pombe|chr 3|||Manual 26 2.5 SPAC18G6.11c |rrn3||ribosomal DNA |Schizosaccharomyces pombe|chr... 25 4.3 SPAC27D7.14c |tpr1|SPAC637.02c|RNA polymerase II associated Paf1... 25 5.7 SPAC1002.19 |urg1||GTP cyclohydrolase II |Schizosaccharomyces po... 24 7.6 SPBC16C6.11 |rpl3201|rpl32-1|60S ribosomal protein L32|Schizosac... 24 7.6 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 24 7.6 SPAC3H5.10 |rpl3202|rpl32-2, rpl32|60S ribosomal protein L32|Sch... 24 7.6 >SPBP23A10.05 |ssr4||SWI/SNF and RSC complex subunit Ssr4|Schizosaccharomyces pombe|chr 2|||Manual Length = 395 Score = 26.6 bits (56), Expect = 1.4 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = +3 Query: 171 VEAAASLSDLHGRRHNYLRISLTERCNLRCKY 266 ++ A + ++H +H + +S T ++RC+Y Sbjct: 96 MDVAGKVLEIHEAKHGFYPLSETRTMHVRCRY 127 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 26.6 bits (56), Expect = 1.4 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Frame = +3 Query: 36 DRNKMKIRTNNFSSLYRIFECDLXTIKSCFRAITVPDRLYSDDSRVEAAASLSDLHGRRH 215 D N T N S + + E + TI SCF + P+R+ + AA S+ RH Sbjct: 204 DYNYFDSPTLNPSDI-TLMERVVNTIASCFCGESTPERVQLQIVKALLAAITSERTIIRH 262 Query: 216 NYLRISLTERCN--LRCK 263 ++L ++ + N L CK Sbjct: 263 SFLLTAVRQTYNIFLLCK 280 >SPCC1840.04 |||caspase|Schizosaccharomyces pombe|chr 3|||Manual Length = 425 Score = 25.8 bits (54), Expect = 2.5 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -1 Query: 228 FAGSCVDDHVGRLMRPPPPHGCHHCTIY 145 +AG +DD + +M P P GC ++ Sbjct: 240 YAGQIIDDEMHEIMVKPLPAGCRLTALF 267 >SPAC18G6.11c |rrn3||ribosomal DNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 599 Score = 25.0 bits (52), Expect = 4.3 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 136 VIARKHDFIVXRSHSKMRYKDEKLLVRI-FILLRSAYCTYV 17 ++ R H F+ + YKDE LL ++ +I + C YV Sbjct: 186 LVPRAHSFLYSSILEEFPYKDESLLAQMTYISNVLSICEYV 226 >SPAC27D7.14c |tpr1|SPAC637.02c|RNA polymerase II associated Paf1 complex subunit Tpr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1039 Score = 24.6 bits (51), Expect = 5.7 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +3 Query: 45 KMKIRTNNFSSLYRIFECDLXTIKSCFRAITVPDRLYSDDSR 170 +++I N+ +S FE +SCF A+ V L++ DS+ Sbjct: 368 QIQILQNDLTSAKLTFERIAEQNQSCFEALVVLGCLHASDSK 409 >SPAC1002.19 |urg1||GTP cyclohydrolase II |Schizosaccharomyces pombe|chr 1|||Manual Length = 439 Score = 24.2 bits (50), Expect = 7.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 132 ITVPDRLYSDDSRVEAAASL 191 IT+PD L +DS+VE A + Sbjct: 397 ITIPDDLIPEDSQVEIDAKI 416 >SPBC16C6.11 |rpl3201|rpl32-1|60S ribosomal protein L32|Schizosaccharomyces pombe|chr 2|||Manual Length = 127 Score = 24.2 bits (50), Expect = 7.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 182 RRLHTAVITVQSIGYSNSPETRFYC 108 RR I++ IGY N+ +TR YC Sbjct: 40 RRRFRGTISMPKIGYGNNKKTR-YC 63 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 24.2 bits (50), Expect = 7.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 222 GSCVDDHVGRLMRPPPPHG 166 G + + +G+ PPPPHG Sbjct: 271 GPLMINDLGKTTAPPPPHG 289 >SPAC3H5.10 |rpl3202|rpl32-2, rpl32|60S ribosomal protein L32|Schizosaccharomyces pombe|chr 1|||Manual Length = 127 Score = 24.2 bits (50), Expect = 7.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 182 RRLHTAVITVQSIGYSNSPETRFYC 108 RR I++ IGY N+ +TR YC Sbjct: 40 RRRFRGTISMPKIGYGNNKKTR-YC 63 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,507,602 Number of Sequences: 5004 Number of extensions: 27227 Number of successful extensions: 55 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 134126124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -