SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov2p23
         (399 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP23A10.05 |ssr4||SWI/SNF and RSC complex subunit Ssr4|Schizos...    27   1.4  
SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo...    27   1.4  
SPCC1840.04 |||caspase|Schizosaccharomyces pombe|chr 3|||Manual        26   2.5  
SPAC18G6.11c |rrn3||ribosomal DNA |Schizosaccharomyces pombe|chr...    25   4.3  
SPAC27D7.14c |tpr1|SPAC637.02c|RNA polymerase II associated Paf1...    25   5.7  
SPAC1002.19 |urg1||GTP cyclohydrolase II |Schizosaccharomyces po...    24   7.6  
SPBC16C6.11 |rpl3201|rpl32-1|60S ribosomal protein L32|Schizosac...    24   7.6  
SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple...    24   7.6  
SPAC3H5.10 |rpl3202|rpl32-2, rpl32|60S ribosomal protein L32|Sch...    24   7.6  

>SPBP23A10.05 |ssr4||SWI/SNF and RSC complex subunit
           Ssr4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 395

 Score = 26.6 bits (56), Expect = 1.4
 Identities = 8/32 (25%), Positives = 19/32 (59%)
 Frame = +3

Query: 171 VEAAASLSDLHGRRHNYLRISLTERCNLRCKY 266
           ++ A  + ++H  +H +  +S T   ++RC+Y
Sbjct: 96  MDVAGKVLEIHEAKHGFYPLSETRTMHVRCRY 127


>SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7
           domain|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1811

 Score = 26.6 bits (56), Expect = 1.4
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 2/78 (2%)
 Frame = +3

Query: 36  DRNKMKIRTNNFSSLYRIFECDLXTIKSCFRAITVPDRLYSDDSRVEAAASLSDLHGRRH 215
           D N     T N S +  + E  + TI SCF   + P+R+     +   AA  S+    RH
Sbjct: 204 DYNYFDSPTLNPSDI-TLMERVVNTIASCFCGESTPERVQLQIVKALLAAITSERTIIRH 262

Query: 216 NYLRISLTERCN--LRCK 263
           ++L  ++ +  N  L CK
Sbjct: 263 SFLLTAVRQTYNIFLLCK 280


>SPCC1840.04 |||caspase|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 425

 Score = 25.8 bits (54), Expect = 2.5
 Identities = 9/28 (32%), Positives = 15/28 (53%)
 Frame = -1

Query: 228 FAGSCVDDHVGRLMRPPPPHGCHHCTIY 145
           +AG  +DD +  +M  P P GC    ++
Sbjct: 240 YAGQIIDDEMHEIMVKPLPAGCRLTALF 267


>SPAC18G6.11c |rrn3||ribosomal DNA |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 599

 Score = 25.0 bits (52), Expect = 4.3
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -3

Query: 136 VIARKHDFIVXRSHSKMRYKDEKLLVRI-FILLRSAYCTYV 17
           ++ R H F+      +  YKDE LL ++ +I    + C YV
Sbjct: 186 LVPRAHSFLYSSILEEFPYKDESLLAQMTYISNVLSICEYV 226


>SPAC27D7.14c |tpr1|SPAC637.02c|RNA polymerase II associated Paf1
           complex subunit Tpr1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1039

 Score = 24.6 bits (51), Expect = 5.7
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +3

Query: 45  KMKIRTNNFSSLYRIFECDLXTIKSCFRAITVPDRLYSDDSR 170
           +++I  N+ +S    FE      +SCF A+ V   L++ DS+
Sbjct: 368 QIQILQNDLTSAKLTFERIAEQNQSCFEALVVLGCLHASDSK 409


>SPAC1002.19 |urg1||GTP cyclohydrolase II |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 439

 Score = 24.2 bits (50), Expect = 7.6
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +3

Query: 132 ITVPDRLYSDDSRVEAAASL 191
           IT+PD L  +DS+VE  A +
Sbjct: 397 ITIPDDLIPEDSQVEIDAKI 416


>SPBC16C6.11 |rpl3201|rpl32-1|60S ribosomal protein
           L32|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 127

 Score = 24.2 bits (50), Expect = 7.6
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -2

Query: 182 RRLHTAVITVQSIGYSNSPETRFYC 108
           RR     I++  IGY N+ +TR YC
Sbjct: 40  RRRFRGTISMPKIGYGNNKKTR-YC 63


>SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex
           subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1522

 Score = 24.2 bits (50), Expect = 7.6
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = -1

Query: 222 GSCVDDHVGRLMRPPPPHG 166
           G  + + +G+   PPPPHG
Sbjct: 271 GPLMINDLGKTTAPPPPHG 289


>SPAC3H5.10 |rpl3202|rpl32-2, rpl32|60S ribosomal protein
           L32|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 127

 Score = 24.2 bits (50), Expect = 7.6
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -2

Query: 182 RRLHTAVITVQSIGYSNSPETRFYC 108
           RR     I++  IGY N+ +TR YC
Sbjct: 40  RRRFRGTISMPKIGYGNNKKTR-YC 63


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,507,602
Number of Sequences: 5004
Number of extensions: 27227
Number of successful extensions: 55
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 55
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 134126124
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -