SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC23C11.16 |plo1||Polo kinase Plo1|Schizosaccharomyces pombe|c...    45   1e-05
SPAC1B9.02c |sck1||serine/threonine protein kinase Sck1|Schizosa...    44   2e-05
SPCC18B5.11c |cds1||replication checkpoint kinase Cds1|Schizosac...    43   4e-05
SPBC725.06c |ppk31|mug25|serine/threonine protein kinase Ppk31 |...    43   4e-05
SPAC644.06c |cdr1|nim1|GIN4 family protein kinase Cdr1|Schizosac...    42   1e-04
SPAC14C4.03 |mek1||Cds1/Rad53/Chk2 family protein kinase Mek1 |S...    42   1e-04
SPBC8D2.19 |mde3||serine/threonine protein kinase Mde3|Schizosac...    41   2e-04
SPAC2C4.14c |ppk11||PAK-related kinase Ppk11|Schizosaccharomyces...    41   2e-04
SPCC320.13c |ark1|aim1, SPCC330.16|aurora-B kinase Ark1|Schizosa...    41   2e-04
SPCC1259.13 |chk1|rad27|Chk1 protein kinase|Schizosaccharomyces ...    41   2e-04
SPAC1F5.09c |shk2|pak2|PAK-related kinase Shk2 |Schizosaccharomy...    40   3e-04
SPAC3C7.06c |pit1||serine/threonine protein kinase Pit1|Schizosa...    40   4e-04
SPBC17F3.02 |nak1|orb3, mor4|PAK-related kinase Nak1|Schizosacch...    40   4e-04
SPBC21.06c |cdc7|pld1, its10|serine/threonine protein kinase Cdc...    40   4e-04
SPBC32C12.03c |ppk25||serine/threonine protein kinase Ppk25 |Sch...    40   6e-04
SPAC9G1.09 |sid1||PAK-related kinase Sid1|Schizosaccharomyces po...    39   0.001
SPAC110.01 |ppk1|SPAC140.05|serine/threonine protein kinase Ppk1...    39   0.001
SPAC890.03 |ppk16|mug92|serine/threonine protein kinase Ppk16 |S...    38   0.002
SPAC23H4.02 |ppk9||serine/threonine protein kinase Ppk9 |Schizos...    37   0.003
SPACUNK12.02c |cmk1||calcium/calmodulin-dependent protein kinase...    37   0.003
SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos...    37   0.003
SPAC1805.01c |ppk6|SPAPJ736.02c|serine/threonine protein kinase ...    36   0.005
SPBC1604.14c |shk1|pak1, orb2|PAK-related kinase Shk1|Schizosacc...    35   0.012
SPBC1D7.05 |byr2|ste8, SPBC2F12.01|MAP kinase kinase kinase Byr2...    35   0.012
SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1 |S...    35   0.012
SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccha...    35   0.012
SPCC74.03c |ssp2|ucp9|serine/threonine protein kinase Ssp2|Schiz...    35   0.016
SPAC1805.05 |cki3||serine/threonine protein kinase Cki3|Schizosa...    34   0.027
SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr 1||...    33   0.036
SPAC22E12.14c |sck2||serine/threonine protein kinase Sck2|Schizo...    33   0.036
SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase ki...    33   0.036
SPAC1D4.13 |byr1|ste1, ste3|MAP kinase kinase Byr1|Schizosacchar...    33   0.048
SPBC16E9.13 |ksp1|ppk20|serine/threonine protein kinase Ksp1 |Sc...    33   0.063
SPCC576.15c |ksg1||serine/threonine protein kinase Ksg1|Schizosa...    33   0.063
SPAC167.01 |ppk4||serine/threonine protein kinase Ppk4 |Schizosa...    32   0.084
SPBC660.14 |mik1||mitotic inhibitor kinase Mik1|Schizosaccharomy...    32   0.11 
SPCC24B10.07 |gad8||serine/threonine protein kinase Gad8 |Schizo...    32   0.11 
SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|S...    32   0.11 
SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk...    31   0.15 
SPCC4G3.08 |psk1||serine/threonine protein kinase Psk1|Schizosac...    31   0.19 
SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb...    31   0.26 
SPCC1322.08 |srk1|mkp1|MAPK-activated protein kinase Srk1|Schizo...    30   0.34 
SPAC3C7.08c |elf1||AAA family ATPase ELf1|Schizosaccharomyces po...    30   0.34 
SPAC821.12 |orb6||serine/threonine protein kinase Orb6|Schizosac...    30   0.45 
SPAC2F3.15 |lsk1||latrunculin sensitive kinase Lsk1 |Schizosacch...    29   0.59 
SPAC19G12.14 |its3||1-phosphatidylinositol-4-phosphate 5-kinase ...    29   0.59 
SPAC4G8.05 |ppk14||serine/threonine protein kinase Ppk14 |Schizo...    29   0.78 
SPAC2F7.03c |pom1||DYRK family protein kinase Pom1|Schizosacchar...    29   1.0  
SPCC63.08c |ppk36|atg1|serine/threonine protein kinase Ppk36|Sch...    28   1.4  
SPCC1919.01 |ppk34|SPCC830.12|serine/threonine protein kinase Pp...    28   1.8  
SPBC1A4.09 |||pseudouridine synthase|Schizosaccharomyces pombe|c...    27   2.4  
SPBC106.10 |pka1|tpk, git6|cAMP-dependent protein kinase catalyt...    27   2.4  
SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom...    27   2.4  
SPAC23G3.11 |rpn6||19S proteasome regulatory subunit Rpn6|Schizo...    27   3.2  
SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccha...    27   4.2  
SPBC119.08 |pmk1|spm1|MAP kinase Pmk1 |Schizosaccharomyces pombe...    27   4.2  
SPBC337.04 |ppk27||serine/threonine protein kinase Ppk27 |Schizo...    27   4.2  
SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosa...    27   4.2  
SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pom...    27   4.2  
SPAC12B10.14c |ppk2||serine/threonine protein kinase Ppk2 |Schiz...    26   5.5  
SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18 |Sch...    26   7.3  
SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosacc...    26   7.3  
SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |S...    25   9.6  
SPAC24B11.11c |sid2||Sid2p-Mob1p kinase complex|Schizosaccharomy...    25   9.6  
SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces...    25   9.6  
SPBC106.01 |mph1|SPBC1271.16c, SPBC243.01|dual specificity prote...    25   9.6  
SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc...    25   9.6  

>SPAC23C11.16 |plo1||Polo kinase Plo1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 683

 Score = 44.8 bits (101), Expect = 1e-05
 Identities = 25/79 (31%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIKVHQ M+ HPN +          N  ++++  +   L E L+ + +L+   V  ++ Q
Sbjct: 88  EIKVHQSMS-HPNIVGFIDCFEDSTNIYLILELCEHKSLMELLRKRKQLTEPEVRYLMMQ 146

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL  +HK   IH D+K
Sbjct: 147 ILGALKYMHKKRVIHRDLK 165


>SPAC1B9.02c |sck1||serine/threonine protein kinase
           Sck1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 696

 Score = 44.4 bits (100), Expect = 2e-05
 Identities = 23/78 (29%), Positives = 40/78 (51%)
 Frame = -3

Query: 235 IKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQL 56
           I V   +++ P  + + F+    ++  ++ DY+   +LF  LQ +G    Q     I +L
Sbjct: 353 ILVRTSLDESPFIVGLKFSFQTASDLYLITDYMSGGELFWHLQHEGRFPEQRAKFYIAEL 412

Query: 55  CEALNDLHKHNFIHNDIK 2
             AL  LHKH+ I+ D+K
Sbjct: 413 VLALEHLHKHDIIYRDLK 430


>SPCC18B5.11c |cds1||replication checkpoint kinase
           Cds1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 460

 Score = 43.2 bits (97), Expect = 4e-05
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  ++ +      +   IVM+Y++  DL + L   G +  Q    +++QL E L  LHK
Sbjct: 228 HPGVVQCHEIFENDDELFIVMEYVEGGDLMDFLIANGSIDEQDCKPLLKQLLETLLHLHK 287

Query: 28  HNFIHNDIK 2
               H DIK
Sbjct: 288 QGVTHRDIK 296


>SPBC725.06c |ppk31|mug25|serine/threonine protein kinase Ppk31
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1032

 Score = 43.2 bits (97), Expect = 4e-05
 Identities = 23/68 (33%), Positives = 34/68 (50%)
 Frame = -3

Query: 205 PNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKH 26
           PN +K+Y+     +   +VMDY +  D    +Q  G L  Q V     +L  A+  LH+ 
Sbjct: 587 PNTVKLYYAFDSGDYLCLVMDYFNGGDCETLIQKLGPLPEQWVCQYAAELLNAIELLHQD 646

Query: 25  NFIHNDIK 2
             IH+DIK
Sbjct: 647 GIIHHDIK 654


>SPAC644.06c |cdr1|nim1|GIN4 family protein kinase
           Cdr1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 593

 Score = 41.9 bits (94), Expect = 1e-04
 Identities = 20/79 (25%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+  HPN +++Y       +  + ++Y+   +LF  ++  G LS +  ++ + Q
Sbjct: 53  EILMMRLLR-HPNILRLYDVWTDHQHMYLALEYVPDGELFHYIRKHGPLSEREAAHYLSQ 111

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + +A+   H+  F H D+K
Sbjct: 112 ILDAVAHCHRFRFRHRDLK 130


>SPAC14C4.03 |mek1||Cds1/Rad53/Chk2 family protein kinase Mek1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 445

 Score = 41.5 bits (93), Expect = 1e-04
 Identities = 22/70 (31%), Positives = 32/70 (45%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN IK+   +       I  + +   DLF  L   G +       I+ Q+ + L  LH
Sbjct: 214 DHPNIIKVNMEYNSETQFFIFEEMVTGGDLFSYLTKLGTVPEVTTLFIMFQILQGLKYLH 273

Query: 31  KHNFIHNDIK 2
           + N IH D+K
Sbjct: 274 EQNIIHRDLK 283


>SPBC8D2.19 |mde3||serine/threonine protein kinase
           Mde3|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 559

 Score = 41.1 bits (92), Expect = 2e-04
 Identities = 20/56 (35%), Positives = 35/56 (62%), Gaps = 2/56 (3%)
 Frame = -3

Query: 163 NQVIVMDYIDCPDLFETLQIK-GEL-SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N  +VM+++DC +LF+  + + G L + +   NI+ Q+   +  +HKH F+H DIK
Sbjct: 98  NIFLVMEFMDC-NLFQLFKRRQGRLFTKETAFNILLQIISGIEHIHKHGFMHRDIK 152


>SPAC2C4.14c |ppk11||PAK-related kinase Ppk11|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 312

 Score = 41.1 bits (92), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 30/51 (58%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I M+Y D     + L++ G  S ++++ ++RQ+ EAL  LH    +H DIK
Sbjct: 79  ITMEYCDGGSCLDLLKLSGTFSERVIAEVMRQVLEALVYLHGQGKMHRDIK 129


>SPCC320.13c |ark1|aim1, SPCC330.16|aurora-B kinase
           Ark1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 355

 Score = 41.1 bits (92), Expect = 2e-04
 Identities = 21/79 (26%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +  H N +++Y +        +++++    +L++ L+     S ++ S  I Q
Sbjct: 137 EIEIQSNLR-HKNILRLYGHFHDEKRIYLILEFAGRGELYQHLRRAKRFSEEVASKYIFQ 195

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+ LHK + IH DIK
Sbjct: 196 MANALSYLHKKHVIHRDIK 214


>SPCC1259.13 |chk1|rad27|Chk1 protein kinase|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 496

 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++H+L N H N I  Y        + +V+++    DLF+ ++    +   +      Q
Sbjct: 61  EIQLHKLCNGHKNIIHFYNTAENPQWRWVVLEFAQGGDLFDKIEPDVGIDEDVAQFYFAQ 120

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E ++ +H     H D+K
Sbjct: 121 LMEGISFMHSKGVAHRDLK 139


>SPAC1F5.09c |shk2|pak2|PAK-related kinase Shk2 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 589

 Score = 40.3 bits (90), Expect = 3e-04
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQV--IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           HPN +  Y +   +  +   +VM+Y++   L + ++ K +L+   ++ I  + C+ +  L
Sbjct: 368 HPNIVT-YLDSFLVRERHLWVVMEYMNAGSLTDIIE-KSKLTEAQIARICLETCKGIQHL 425

Query: 34  HKHNFIHNDIK 2
           H  N IH DIK
Sbjct: 426 HARNIIHRDIK 436


>SPAC3C7.06c |pit1||serine/threonine protein kinase
           Pit1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 650

 Score = 39.9 bits (89), Expect = 4e-04
 Identities = 18/53 (33%), Positives = 35/53 (66%), Gaps = 2/53 (3%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGE--LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           IVM+++DC +L++ +  +    L+ + V +I+RQ+ + LN +H + F H D+K
Sbjct: 112 IVMEFLDC-NLYQLISTRKNDPLTLEQVQDIMRQIFKGLNHIHTNGFFHRDMK 163


>SPBC17F3.02 |nak1|orb3, mor4|PAK-related kinase
           Nak1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 652

 Score = 39.9 bits (89), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 36/71 (50%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           +D  N IK + ++    N  I+MDY     +  TL   G +S   +S I+R+  +AL  +
Sbjct: 66  SDVENIIKYHGSYLVGTNLWIIMDYCHGGSV-RTLMEAGPISEPCISLILRETLQALKFI 124

Query: 34  HKHNFIHNDIK 2
           H    IH DIK
Sbjct: 125 HHAGIIHRDIK 135


>SPBC21.06c |cdc7|pld1, its10|serine/threonine protein kinase
           Cdc7|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1062

 Score = 39.9 bits (89), Expect = 4e-04
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -3

Query: 256 ANFNVDEIKVHQLMN-DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL 80
           ++ +V ++++  L N DHPN +K   ++   ++  I+++Y +   L    +  G++   L
Sbjct: 48  SDLSVIKMEIDLLKNLDHPNIVKYRGSYQTNDSLCIILEYCENGSLRSICKNFGKIPENL 107

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V+    Q+ + L  LH    IH DIK
Sbjct: 108 VALYTFQVLQGLLYLHNQGVIHRDIK 133


>SPBC32C12.03c |ppk25||serine/threonine protein kinase Ppk25
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 423

 Score = 39.5 bits (88), Expect = 6e-04
 Identities = 25/94 (26%), Positives = 39/94 (41%)
 Frame = -3

Query: 283 IVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI 104
           I F  NN      V    +   +  HPN  ++           I+ +Y+    L E +  
Sbjct: 84  IPFTPNNTSQTVRVQREALLGRLLRHPNICRVIDCIRTPACTYILFEYVPGGQLLEYILA 143

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +G+L   L  +   QL  AL  LHK+  +H D+K
Sbjct: 144 RGKLDEDLARSFAMQLINALVYLHKNFIVHRDLK 177


>SPAC9G1.09 |sid1||PAK-related kinase Sid1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 471

 Score = 38.7 bits (86), Expect = 0.001
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I+M+++D   +   L++ G L+ Q++S I+R++   LN LH  N IH DIK
Sbjct: 82  ILMEHMDGGSVSGLLKM-GRLNEQVISIILREVLYGLNYLHGQNKIHRDIK 131


>SPAC110.01 |ppk1|SPAC140.05|serine/threonine protein kinase Ppk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1023

 Score = 38.7 bits (86), Expect = 0.001
 Identities = 19/73 (26%), Positives = 36/73 (49%)
 Frame = -3

Query: 220 LMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALN 41
           L N+HP+ +K        ++  IV+DY++  +LF+ +  +  L   +   +  QL   + 
Sbjct: 553 LGNNHPHIVKYLDFVKTKHHFGIVLDYVNGGELFDYILARRRLEDSVACRLFAQLISGVA 612

Query: 40  DLHKHNFIHNDIK 2
            LH    +H D+K
Sbjct: 613 YLHSRGVVHRDLK 625


>SPAC890.03 |ppk16|mug92|serine/threonine protein kinase Ppk16
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 672

 Score = 37.5 bits (83), Expect = 0.002
 Identities = 18/69 (26%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN  ++Y      +   + M+Y    +L++ +  +  L  +    I+ QLC A+  LH+
Sbjct: 82  HPNITRLYEVVCTEDRIYLAMEYCPNGELYDWVAREKRLDEKTTCRIMWQLCCAIQYLHR 141

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 142 QGCVHRDLK 150


>SPAC23H4.02 |ppk9||serine/threonine protein kinase Ppk9
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 532

 Score = 37.1 bits (82), Expect = 0.003
 Identities = 20/69 (28%), Positives = 30/69 (43%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I +Y         V+ ++Y+D  DL   +     L       I RQ+  A++  H 
Sbjct: 80  HPNIITLYQVFRVPKYTVLALEYMDT-DLHSMVVKHNRLDECTTRKIFRQIVHAIDYCHL 138

Query: 28  HNFIHNDIK 2
           H   H D+K
Sbjct: 139 HRVAHRDLK 147


>SPACUNK12.02c |cmk1||calcium/calmodulin-dependent protein kinase
           Cmk1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 335

 Score = 37.1 bits (82), Expect = 0.003
 Identities = 19/85 (22%), Positives = 42/85 (49%), Gaps = 1/85 (1%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMN-DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           +F  +EI + + ++ +HPN + +      +NN  ++ +     +LF+ +  KG       
Sbjct: 72  DFVKNEIAILKRVSYEHPNILHLVDFFETVNNLYLITELATGGELFDRICAKGSFYEADA 131

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
           + ++R    A+  LH +  +H D+K
Sbjct: 132 AALMRTTTSAVKYLHDNGIVHRDLK 156


>SPCC1450.11c |cek1||serine/threonine protein kinase
           Cek1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1338

 Score = 37.1 bits (82), Expect = 0.003
 Identities = 20/70 (28%), Positives = 31/70 (44%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           + P   K+Y+     +   +VM+Y++  D    L+  G L    +   I +    L DLH
Sbjct: 646 ESPFVAKLYYTFQSKDYLYLVMEYLNGGDCGSLLKTMGVLDLDWIRTYIAETVLCLGDLH 705

Query: 31  KHNFIHNDIK 2
               IH DIK
Sbjct: 706 DRGIIHRDIK 715


>SPAC1805.01c |ppk6|SPAPJ736.02c|serine/threonine protein kinase
           Ppk6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 775

 Score = 36.3 bits (80), Expect = 0.005
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = -3

Query: 214 NDHPNFIK-IYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           + HPN +K I F     N  ++        DLF+ +++K  +S +    I  Q+  A+  
Sbjct: 567 HSHPNIVKMITFFEDNENYYLLTEPQKPGIDLFDYIELKPSISEKESKAIFFQIALAVAH 626

Query: 37  LHKHNFIHNDIK 2
           LH  + IH DIK
Sbjct: 627 LHSFDIIHRDIK 638


>SPBC1604.14c |shk1|pak1, orb2|PAK-related kinase
           Shk1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 658

 Score = 35.1 bits (77), Expect = 0.012
 Identities = 23/83 (27%), Positives = 40/83 (48%)
 Frame = -3

Query: 250 FNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSN 71
           F V+EI V +  + H N +       + +   +VM+Y+    L E +     LS   ++ 
Sbjct: 427 FIVNEILVMK-SHHHKNIVNFIDTFFYKSELWMVMEYMRGGSLTEVVT-NNTLSEGQIAA 484

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           I ++  E L  LH++  +H DIK
Sbjct: 485 ICKETLEGLQHLHENGIVHRDIK 507


>SPBC1D7.05 |byr2|ste8, SPBC2F12.01|MAP kinase kinase kinase
           Byr2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 659

 Score = 35.1 bits (77), Expect = 0.012
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I ++Y+    +   L + G     LV N I+Q  + L  LH    +H DIK
Sbjct: 474 IFLEYVPGGSVAGLLTMYGSFEETLVKNFIKQTLKGLEYLHSRGIVHRDIK 524


>SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 891

 Score = 35.1 bits (77), Expect = 0.012
 Identities = 13/51 (25%), Positives = 30/51 (58%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +V +++D   + + +   G+L  +     +RQ+  AL+ LH+++ +H D+K
Sbjct: 218 MVFEFVDGGQMLDYIISHGKLKEKQARKFVRQIGSALSYLHQNSVVHRDLK 268


>SPAC57A10.02 |cdr2||GIN4 family protein kinase
           Cdr2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 775

 Score = 35.1 bits (77), Expect = 0.012
 Identities = 17/70 (24%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +HPN +++           +V++Y+   +LF+ +  KG  + Q  +  + Q+   L   H
Sbjct: 66  EHPNVLQLIDVISAQEQLFVVVEYMPGGELFDCMLRKGSFTEQDTAKFLWQILCGLEYCH 125

Query: 31  KHNFIHNDIK 2
           K +  H D+K
Sbjct: 126 KLHICHRDLK 135


>SPCC74.03c |ssp2|ucp9|serine/threonine protein kinase
           Ssp2|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 576

 Score = 34.7 bits (76), Expect = 0.016
 Identities = 21/79 (26%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HP+ IK+Y       + V+V++Y    +LF+ +  K  ++        +Q
Sbjct: 82  EISYLKLLR-HPHIIKLYDVITTPTDIVMVIEYAG-GELFDYIVEKKRMTEDEGRRFFQQ 139

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+H  +H D+K
Sbjct: 140 IICAIEYCHRHKIVHRDLK 158


>SPAC1805.05 |cki3||serine/threonine protein kinase
           Cki3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 439

 Score = 33.9 bits (74), Expect = 0.027
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 3/83 (3%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYF--NHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSN 71
           DE   ++L+   P    +Y+    G  N  ++VMD +  P L +     G   S + V+ 
Sbjct: 57  DEYLTYKLLMGLPGIPSVYYYGQEGMYN--LLVMDLLG-PSLEDLFDYCGRRFSPKTVAM 113

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           I +Q+   +  +H+ +FI+ DIK
Sbjct: 114 IAKQMITRIQSVHERHFIYRDIK 136


>SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1116

 Score = 33.5 bits (73), Expect = 0.036
 Identities = 19/70 (27%), Positives = 31/70 (44%)
 Frame = -3

Query: 211  DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
            DH N ++         +  I ++Y+    +   L+  G    QLV  + RQ+   L+ LH
Sbjct: 888  DHLNIVQYLGFEKTETDISIFLEYVSGGSIGRCLRNYGPFEEQLVRFVSRQVLYGLSYLH 947

Query: 31   KHNFIHNDIK 2
                IH D+K
Sbjct: 948  SKGIIHRDLK 957


>SPAC22E12.14c |sck2||serine/threonine protein kinase
           Sck2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 646

 Score = 33.5 bits (73), Expect = 0.036
 Identities = 21/79 (26%), Positives = 34/79 (43%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           +I V     D P  + + F+     +  +V DY+   +LF  LQ       +     I +
Sbjct: 316 DILVQTSAADSPFIVALRFSFQTPKDLYLVTDYMAGGELFWHLQKSVRFPEERAKFYIAE 375

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  AL  LHK   ++ D+K
Sbjct: 376 LLLALQALHKRGIVYRDLK 394


>SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase kinase
            Win1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1436

 Score = 33.5 bits (73), Expect = 0.036
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211  DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI-IRQLCEALNDL 35
            DHPN +  Y          I M+      LFE L+  G +  +LV  + + QL E L  +
Sbjct: 1177 DHPNVVSYYGIEVHREKVNIFMELCQGSSLFEFLRY-GRIEDELVIQVYVLQLLEGLAYI 1235

Query: 34   HKHNFIHNDIK 2
            H     H D+K
Sbjct: 1236 HSCGVSHQDVK 1246


>SPAC1D4.13 |byr1|ste1, ste3|MAP kinase kinase
           Byr1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 340

 Score = 33.1 bits (72), Expect = 0.048
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -3

Query: 205 PNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK- 29
           P  +  Y    + NN  + M+Y+DC  L   L+  G +   ++  II  + + L  L+  
Sbjct: 120 PYIVGFYGAFQYKNNISLCMEYMDCGSLDAILREGGPIPLDILGKIINSMVKGLIYLYNV 179

Query: 28  HNFIHNDIK 2
            + IH D+K
Sbjct: 180 LHIIHRDLK 188


>SPBC16E9.13 |ksp1|ppk20|serine/threonine protein kinase Ksp1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 474

 Score = 32.7 bits (71), Expect = 0.063
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 6/69 (8%)
 Frame = -3

Query: 190 IYFNHGFINN--QVIVMDYIDCPDLFETLQIK----GELSHQLVSNIIRQLCEALNDLHK 29
           I+F   F +N    +V++Y    DL+E +        +   +++ NI  Q+ + +  LH 
Sbjct: 71  IHFVESFEDNVYYYVVLEYCPLGDLYECILNNDFPNAKNQPEMIKNIFLQIIDGVAHLHS 130

Query: 28  HNFIHNDIK 2
           H   H D+K
Sbjct: 131 HGIYHRDLK 139


>SPCC576.15c |ksg1||serine/threonine protein kinase
           Ksg1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 592

 Score = 32.7 bits (71), Expect = 0.063
 Identities = 14/73 (19%), Positives = 33/73 (45%)
 Frame = -3

Query: 220 LMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALN 41
           +++ HP FIK+++     +N   V+      +L + +   G  +          + ++++
Sbjct: 153 ILSKHPGFIKLFYTFQDAHNLYFVLSLARNGELLDYINKLGRFNEICAQYYAALIVDSID 212

Query: 40  DLHKHNFIHNDIK 2
            +H    IH D+K
Sbjct: 213 YMHGRGVIHRDLK 225


>SPAC167.01 |ppk4||serine/threonine protein kinase Ppk4
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1072

 Score = 32.3 bits (70), Expect = 0.084
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 4/83 (4%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDC--PDLFETLQIKGEL--SHQLVSN 71
           EI + Q  ++HPN ++ Y          IV++   C   DL E      +L  S  LVS 
Sbjct: 695 EITLLQQSDNHPNIVRYYCKQKSDQFLYIVIELCKCNLSDLIEKPIAYDDLFKSIDLVS- 753

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           ++ Q+   ++ LH  + +H D+K
Sbjct: 754 LLYQIAFGVSHLHSLDLVHRDLK 776


>SPBC660.14 |mik1||mitotic inhibitor kinase Mik1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 581

 Score = 31.9 bits (69), Expect = 0.11
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 3/89 (3%)
 Frame = -3

Query: 259 GANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQ- 83
           G   ++ E+ + Q +   P  + +     + +N  + +DY +  DL   L   G L    
Sbjct: 331 GKERHLQEVSILQRLQACPFVVNLVNVWSYNDNIFLQLDYCENGDLSLFLSELGLLQVMD 390

Query: 82  --LVSNIIRQLCEALNDLHKHNFIHNDIK 2
              V  ++ QL +ALN +H   F+H D+K
Sbjct: 391 PFRVWKMLFQLTQALNFIHLLEFVHLDVK 419


>SPCC24B10.07 |gad8||serine/threonine protein kinase Gad8
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 569

 Score = 31.9 bits (69), Expect = 0.11
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           ++P  + + F+        +V+ +++  +LF  LQ +G          I +L  AL  LH
Sbjct: 286 NNPFIVPLKFSFQSPGKLYLVLAFVNGGELFHHLQREGCFDTYRAKFYIAELLVALECLH 345

Query: 31  KHNFIHNDIK 2
           + N I+ D+K
Sbjct: 346 EFNVIYRDLK 355


>SPCC417.06c |ppk35|mug27|serine/threonine protein kinase
           Ppk35|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 624

 Score = 31.9 bits (69), Expect = 0.11
 Identities = 15/65 (23%), Positives = 30/65 (46%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y+         + M+Y+   D    L  KG L        + ++  A++ +HK  ++
Sbjct: 223 VKLYYAFQDKEKVYLAMEYVPGGDFRTFLTTKGLLHENQTRFYLAEMVAAISAVHKLGYM 282

Query: 16  HNDIK 2
           H D+K
Sbjct: 283 HRDLK 287


>SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 306

 Score = 31.5 bits (68), Expect = 0.15
 Identities = 20/68 (29%), Positives = 30/68 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+  +I     FI+N+   +  I     F    +  E+S      I+ Q+  AL  L K
Sbjct: 65  HPHIERIV--DSFIDNEAGSVYLITSFKSFVLSDVMDEISIDTKCKIVLQISSALEYLEK 122

Query: 28  HNFIHNDI 5
           H  +H DI
Sbjct: 123 HGILHRDI 130


>SPCC4G3.08 |psk1||serine/threonine protein kinase
           Psk1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 436

 Score = 31.1 bits (67), Expect = 0.19
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP   ++Y+     +   +++ Y    +LF  L  +  L   +V+    +L  AL  LHK
Sbjct: 149 HPFICRLYYAFQDHDRLYLILQYAPGGELFSHLAEQRMLPEDVVAFYTAELTLALIHLHK 208

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 209 LGIVYRDLK 217


>SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 2685

 Score = 30.7 bits (66), Expect = 0.26
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 5/50 (10%)
 Frame = -3

Query: 271  ENNFGANFNVDEIKVHQLMNDHP-----NFIKIYFNHGFINNQVIVMDYI 137
            EN+  +NFN  EI+  +  N  P     N I  YFNH F N Q++   +I
Sbjct: 2278 ENSDASNFNTLEIEFMKGSNLAPGCQFENIICPYFNHEFSNEQLLQQKFI 2327


>SPCC1322.08 |srk1|mkp1|MAPK-activated protein kinase
           Srk1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 580

 Score = 30.3 bits (65), Expect = 0.34
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I++           +V++  D  +LF  +      S  L  ++I Q+  A+  LH+
Sbjct: 190 HPNIIQLLEFIQTPEYYYLVLELADGGELFHQIVRLTYFSEDLSRHVITQVAHAIRYLHE 249

Query: 28  H-NFIHNDIK 2
               +H DIK
Sbjct: 250 DCGVVHRDIK 259


>SPAC3C7.08c |elf1||AAA family ATPase ELf1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1057

 Score = 30.3 bits (65), Expect = 0.34
 Identities = 14/42 (33%), Positives = 23/42 (54%)
 Frame = -3

Query: 133 CPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHND 8
           C +L E +     + H+L ++II  +C+AL  L+K N    D
Sbjct: 350 CKELREAVLKNTSVPHELANSIIDYVCDALAALYKSNNFDKD 391


>SPAC821.12 |orb6||serine/threonine protein kinase
           Orb6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 469

 Score = 29.9 bits (64), Expect = 0.45
 Identities = 16/71 (22%), Positives = 32/71 (45%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           +D P  + +Y+         ++M+++   DL   L      S  +    + +   A+ D+
Sbjct: 148 SDSPWVVSLYYAFQDSLYLYLIMEFLPGGDLMTMLINYDTFSEDVTRFYMAECVLAIADV 207

Query: 34  HKHNFIHNDIK 2
           H+  +IH DIK
Sbjct: 208 HRMGYIHRDIK 218


>SPAC2F3.15 |lsk1||latrunculin sensitive kinase Lsk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 593

 Score = 29.5 bits (63), Expect = 0.59
 Identities = 20/81 (24%), Positives = 39/81 (48%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           V E+K+ Q +  H N +++       ++  +V +Y+D       L  +   +   + ++ 
Sbjct: 322 VREVKILQRLR-HKNIVRLLEIMVEKSSVYMVFEYMDHDLTGVLLNSQLHFTPGNIKHLS 380

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+ EAL  LH    +H DIK
Sbjct: 381 KQIFEALAYLHHRGVLHRDIK 401


>SPAC19G12.14 |its3||1-phosphatidylinositol-4-phosphate 5-kinase
           Its3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 742

 Score = 29.5 bits (63), Expect = 0.59
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = -1

Query: 456 RLYRFIFTIRHGHHHRHKCTLQTLVQFYENCKN 358
           R YRFI  I+  HH  HK   + L  +YE+ KN
Sbjct: 372 RDYRFI--IKTIHHSEHKFLREILYDYYEHVKN 402


>SPAC4G8.05 |ppk14||serine/threonine protein kinase Ppk14
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 566

 Score = 29.1 bits (62), Expect = 0.78
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 4/75 (5%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQVIV--MDYIDCPDLFETLQIK-GE-LSHQLVSNIIRQLCEA 47
           ++HP  + +Y  H F +++ +   M+Y    + F  LQ + G  LS       I ++  A
Sbjct: 250 SNHPFIVTLY--HSFQSDEYLYLCMEYCMGGEFFRALQRRPGRCLSENEAKFYIAEVTAA 307

Query: 46  LNDLHKHNFIHNDIK 2
           L  LH   FI+ D+K
Sbjct: 308 LEYLHLMGFIYRDLK 322


>SPAC2F7.03c |pom1||DYRK family protein kinase
           Pom1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1087

 Score = 28.7 bits (61), Expect = 1.0
 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = -3

Query: 187 YFNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNIIRQLCEALNDLHKHNFIH 14
           Y +H +  + + V   +   +L+E ++  G   L   ++ +I RQL + L  L++ + IH
Sbjct: 764 YTDHFYFRDHLCVATELLGKNLYELIKSNGFKGLPIVVIKSITRQLIQCLTLLNEKHVIH 823

Query: 13  NDIK 2
            D+K
Sbjct: 824 CDLK 827


>SPCC63.08c |ppk36|atg1|serine/threonine protein kinase
           Ppk36|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 830

 Score = 28.3 bits (60), Expect = 1.4
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = -3

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           K  L+  LV +  +QL  AL  L   + IH D+K
Sbjct: 126 KAGLNETLVRHFTQQLASALQFLRSRSLIHRDVK 159


>SPCC1919.01 |ppk34|SPCC830.12|serine/threonine protein kinase
           Ppk34|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 354

 Score = 27.9 bits (59), Expect = 1.8
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 7/77 (9%)
 Frame = -3

Query: 211 DHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSH-----QLVSNIIRQLC 53
           DH N +K+Y   N  + ++  +V++Y  CP   +   +   +S      +      RQL 
Sbjct: 129 DHENVVKLYQVINSDYKDSLCMVLNY--CPG-GKLASVDHGISFDPMPLETCRKSFRQLV 185

Query: 52  EALNDLHKHNFIHNDIK 2
            A+N +H    IH DIK
Sbjct: 186 LAVNYIHGKGVIHRDIK 202


>SPBC1A4.09 |||pseudouridine synthase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 680

 Score = 27.5 bits (58), Expect = 2.4
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 3/34 (8%)
 Frame = -3

Query: 106 IKGELSHQLVSNII---RQLCEALNDLHKHNFIH 14
           +KG   H +V N+I    ++ EALN L +H FI+
Sbjct: 328 LKGNEFHIVVRNVITPKEKVVEALNSLKEHGFIN 361


>SPBC106.10 |pka1|tpk, git6|cAMP-dependent protein kinase catalytic
           subunit Pka1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 512

 Score = 27.5 bits (58), Expect = 2.4
 Identities = 15/69 (21%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP    ++       N  +VMD+ +  +LF  L+       ++      ++  AL+ LH 
Sbjct: 258 HPFITILWGTFQDAKNLFMVMDFAEGGELFSLLRKCHRFPEKVAKFYAAEVILALDYLHH 317

Query: 28  HNFIHNDIK 2
           +  ++ D+K
Sbjct: 318 NQIVYRDLK 326


>SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1016

 Score = 27.5 bits (58), Expect = 2.4
 Identities = 16/69 (23%), Positives = 30/69 (43%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  + ++           VMD++   DL   +Q + + S +       ++C AL   H 
Sbjct: 743 HPFLVNLHSCFQTETRIYFVMDFVSGGDLMLHIQ-QEQFSRRRAQFYAAEVCLALKYFHD 801

Query: 28  HNFIHNDIK 2
           +  I+ D+K
Sbjct: 802 NGIIYRDLK 810


>SPAC23G3.11 |rpn6||19S proteasome regulatory subunit
           Rpn6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 421

 Score = 27.1 bits (57), Expect = 3.2
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDI 5
           NN V   D     DL++ +  KG    + V+N   Q    L+DL+     HND+
Sbjct: 11  NNAVKSNDIEKAIDLYKEVLNKGVSKDEKVANEQEQALTNLSDLYVRENRHNDL 64


>SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase
           Wis1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 605

 Score = 26.6 bits (56), Expect = 4.2
 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 2/87 (2%)
 Frame = -3

Query: 256 ANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIV-MDYIDCPDLFETLQIKGELSHQL 80
           A FN   +++  L      +I  ++   F+   V + M+Y+D   + + L   G     +
Sbjct: 358 ATFNQIIMELDILHKAVSPYIVDFYGAFFVEGSVFICMEYMDAGSM-DKLYAGGIKDEGV 416

Query: 79  VSNIIRQLCEALNDL-HKHNFIHNDIK 2
           ++     + + L  L  +HN IH D+K
Sbjct: 417 LARTAYAVVQGLKTLKEEHNIIHRDVK 443


>SPBC119.08 |pmk1|spm1|MAP kinase Pmk1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 422

 Score = 26.6 bits (56), Expect = 4.2
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 4/83 (4%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFIN----NQVIVMDYIDCPDLFETLQIKGELSHQLVSN 71
           EIK+     +H N   IY +   IN    N+V + + +   DL   ++    L+     +
Sbjct: 70  EIKLLIHFRNHRNITCIY-DLDIINPYNFNEVYIYEELMEADLNAIIKSGQPLTDAHFQS 128

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
            I Q+   L  +H  N IH D+K
Sbjct: 129 FIYQILCGLKYIHSANVIHRDLK 151


>SPBC337.04 |ppk27||serine/threonine protein kinase Ppk27
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 413

 Score = 26.6 bits (56), Expect = 4.2
 Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HP  +++   +      ++V +Y    DL+  T +   + S + V  I  +L   +  LH
Sbjct: 164 HPCVVQLLNYYVSSAELILVENYCMGGDLYHYTKKHHSDFSLEFVGRIFSELVHTVAYLH 223

Query: 31  KHNFIHNDIK 2
               IH D+K
Sbjct: 224 SKCLIHRDLK 233


>SPCC18B5.03 |wee1||dual specificity protein kinase
           Wee1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 877

 Score = 26.6 bits (56), Expect = 4.2
 Identities = 17/84 (20%), Positives = 37/84 (44%), Gaps = 3/84 (3%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIY--FNHG-FINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
           + E+ + + +  H + +++   + HG F+  QV + +        E       L    V 
Sbjct: 612 LQEVSIQRALKGHDHIVELMDSWEHGGFLYMQVELCENGSLDRFLEEQGQLSRLDEFRVW 671

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
            I+ ++   L  +H  N++H D+K
Sbjct: 672 KILVEVALGLQFIHHKNYVHLDLK 695


>SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1562

 Score = 26.6 bits (56), Expect = 4.2
 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 2/30 (6%)
 Frame = -3

Query: 118 ETLQIKGE--LSHQLVSNIIRQLCEALNDL 35
           ET  + GE  L  +LV++ +R LC+ +NDL
Sbjct: 459 ETAALDGETSLKTRLVNSTLRSLCKDINDL 488


>SPAC12B10.14c |ppk2||serine/threonine protein kinase Ppk2
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 665

 Score = 26.2 bits (55), Expect = 5.5
 Identities = 16/68 (23%), Positives = 29/68 (42%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N I+   +  ++NN   V +Y D       L  K   S   +++I  ++   L  LH 
Sbjct: 442 HKNLIRYNESFWYLNNIWSVFEYKDPSTKLSALIPKYFFSELNIASICYEISSGLAFLHN 501

Query: 28  HNFIHNDI 5
               H+++
Sbjct: 502 SGIAHHNL 509


>SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1316

 Score = 25.8 bits (54), Expect = 7.3
 Identities = 15/64 (23%), Positives = 28/64 (43%)
 Frame = -3

Query: 193 KIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIH 14
           K+Y+     +   +VM++++  D    L+    +        I ++   L  LH+   IH
Sbjct: 627 KLYYAFQSRDYLYLVMEFMNGGDCASLLKSLYTIPESWAKIYIAEVALGLEHLHRLGIIH 686

Query: 13  NDIK 2
            DIK
Sbjct: 687 RDIK 690


>SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein
           4|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 636

 Score = 25.8 bits (54), Expect = 7.3
 Identities = 13/50 (26%), Positives = 20/50 (40%)
 Frame = -3

Query: 151 VMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           VM+     DL+  +   G L         +QL   ++ LH     H D+K
Sbjct: 434 VMELCSGGDLYTLIMAAGRLEPMEADCFFKQLMRGVDYLHDMGVAHRDLK 483


>SPBC29A10.10c |||tRNA-splicing endonuclease positive effector
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1944

 Score = 25.4 bits (53), Expect = 9.6
 Identities = 15/55 (27%), Positives = 27/55 (49%)
 Frame = -3

Query: 364 QKRQNSV*NNQRAFWQNIYFIAQAH*QIVFAENNFGANFNVDEIKVHQLMNDHPN 200
           QK++N   N  + F + +  + + H   ++     G NFNV +  +  L +DH N
Sbjct: 238 QKKENE--NEMQIFLKGLSLLLK-HVDHLYFRGLTGKNFNVADFILSGLQSDHTN 289


>SPAC24B11.11c |sid2||Sid2p-Mob1p kinase complex|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 607

 Score = 25.4 bits (53), Expect = 9.6
 Identities = 13/55 (23%), Positives = 25/55 (45%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +N  + M+++   D    L   G L          ++  A++ LH+  +IH D+K
Sbjct: 279 SNIYLAMEFVPGGDFRTLLSNSGVLRDHHAKFYATEMFLAIDALHQLGYIHRDLK 333


>SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 3699

 Score = 25.4 bits (53), Expect = 9.6
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +3

Query: 663  YYNAVVKMKRLVINVRDPSLRQSLYNTIAYIERC*ISAR*TIAKL 797
            Y  +V+      I + DP ++Q+ Y TIA    C ISA  T AK+
Sbjct: 1827 YRKSVIMSAWNYIKLEDPMVKQAAYATIA----CFISAYDTPAKI 1867


>SPBC106.01 |mph1|SPBC1271.16c, SPBC243.01|dual specificity protein
           kinase Mph1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 678

 Score = 25.4 bits (53), Expect = 9.6
 Identities = 19/85 (22%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYI-DC--PDLFETLQ--IKGELSHQLV 77
           +EI + + ++ +   IK+Y     +N+ +  ++ + +C   DL   L   +K  ++   +
Sbjct: 362 NEIALLRKLSGNDRIIKLYAAE--VNDTLGQLNMVMECGETDLANLLMKNMKKPINLNFI 419

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
                Q+ EA+  +H  N +H+D+K
Sbjct: 420 RMYWEQMLEAVQVVHDQNIVHSDLK 444


>SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1576

 Score = 25.4 bits (53), Expect = 9.6
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -3

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           + RQ+ EAL  +H    +H D+K
Sbjct: 752 LFRQILEALAYIHSRGMMHRDLK 774


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,067,291
Number of Sequences: 5004
Number of extensions: 62778
Number of successful extensions: 294
Number of sequences better than 10.0: 67
Number of HSP's better than 10.0 without gapping: 278
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 292
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 394431430
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -